OPP20242459KR KR 10-2023-0110887 2023-08-23 LG CHEM, LTD. Method of selecting Neoantigen for Development of Personalized Cancer Vaccine 134 181 AA PAT REGION 1..181 note HLA-A0201 source 1..181 mol_type protein organism synthetic construct SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRT 181 AA PAT REGION 1..181 note HLA-A1101 source 1..181 mol_type protein organism synthetic construct SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRT 181 AA PAT REGION 1..181 note HLA-A2402 source 1..181 mol_type protein organism synthetic construct SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRT 9 AA PAT REGION 1..9 note neoantigen candidate (A0201) (Melanoma) source 1..9 mol_type protein organism synthetic construct YLFNFVVNV 9 AA PAT REGION 1..9 note neoantigen candidate (A0201) (Melanoma) source 1..9 mol_type protein organism synthetic construct RLAEFIIGM 10 AA PAT REGION 1..10 note neoantigen candidate (A0201) (Melanoma) source 1..10 mol_type protein organism synthetic construct YLFNFVVNVG 10 AA PAT REGION 1..10 note neoantigen candidate (A0201) (Melanoma) source 1..10 mol_type protein organism synthetic construct RLAEFIIGMM 10 AA PAT REGION 1..10 note neoantigen candidate (A0201) (Melanoma) source 1..10 mol_type protein organism synthetic construct LLTDIIPDGV 9 AA PAT REGION 1..9 note neoantigen candidate (A0201) (Melanoma) source 1..9 mol_type protein organism synthetic construct FLALCADAV 9 AA PAT REGION 1..9 note neoantigen candidate (A0201) (Melanoma) source 1..9 mol_type protein organism synthetic construct YIAGILARI 11 AA PAT REGION 1..11 note neoantigen candidate (A0201) (Melanoma) source 1..11 mol_type protein organism synthetic construct RLAEFIIGMMG 9 AA PAT REGION 1..9 note neoantigen candidate (A0201) (Melanoma) source 1..9 mol_type protein organism synthetic construct YLMVALASV 12 AA PAT REGION 1..12 note neoantigen candidate (A0201) (Melanoma) source 1..12 mol_type protein organism synthetic construct RLAEFIIGMMGT 9 AA PAT REGION 1..9 note neoantigen candidate (A0201) (Melanoma) source 1..9 mol_type protein organism synthetic construct GLVECLPEI 10 AA PAT REGION 1..10 note neoantigen candidate (A0201) (Melanoma) source 1..10 mol_type protein organism synthetic construct AYLFNFVVNV 9 AA PAT REGION 1..9 note neoantigen candidate (A0201) (Melanoma) source 1..9 mol_type protein organism synthetic construct VLFYLSSAV 9 AA PAT REGION 1..9 note neoantigen candidate (A0201) (Melanoma) source 1..9 mol_type protein organism synthetic construct RLFFCFMNV 9 AA PAT REGION 1..9 note neoantigen candidate (A0201) (Melanoma) source 1..9 mol_type protein organism synthetic construct CILAVLPSL 9 AA PAT REGION 1..9 note neoantigen candidate (A0201) (Melanoma) source 1..9 mol_type protein organism synthetic construct IMFNKGFLA 10 AA PAT REGION 1..10 note neoantigen candidate (A0201) (Melanoma) source 1..10 mol_type protein organism synthetic construct KTDPWFLLAV 12 AA PAT REGION 1..12 note neoantigen candidate (A0201) (Melanoma) source 1..12 mol_type protein organism synthetic construct SLIGVSFFALPV 10 AA PAT REGION 1..10 note neoantigen candidate (A0201) (Melanoma) source 1..10 mol_type protein organism synthetic construct SLWAESLVHV 10 AA PAT REGION 1..10 note neoantigen candidate (A0201) (Melanoma) source 1..10 mol_type protein organism synthetic construct FLLAVLGAPV 10 AA PAT REGION 1..10 note neoantigen candidate (A2402) (Melanoma) source 1..10 mol_type protein organism synthetic construct TFYWTFVNAF 10 AA PAT REGION 1..10 note neoantigen candidate (A2402) (Melanoma) source 1..10 mol_type protein organism synthetic construct VFYQFSKLIF 11 AA PAT REGION 1..11 note neoantigen candidate (A2402) (Melanoma) source 1..11 mol_type protein organism synthetic construct RMYSSWRLLNL 10 AA PAT REGION 1..10 note neoantigen candidate (A2402) (Melanoma) source 1..10 mol_type protein organism synthetic construct TWNVHQQFLW 9 AA PAT REGION 1..9 note neoantigen candidate (A2402) (Melanoma) source 1..9 mol_type protein organism synthetic construct RMYSSWRLL 12 AA PAT REGION 1..12 note neoantigen candidate (A2402) (Melanoma) source 1..12 mol_type protein organism synthetic construct FYWTFVNAFSIF 11 AA PAT REGION 1..11 note neoantigen candidate (A2402) (Melanoma) source 1..11 mol_type protein organism synthetic construct QWILKTRAYFL 9 AA PAT REGION 1..9 note neoantigen candidate (A2402) (Melanoma) source 1..9 mol_type protein organism synthetic construct STWNVHQQF 10 AA PAT REGION 1..10 note neoantigen candidate (A2402) (Melanoma) source 1..10 mol_type protein organism synthetic construct QWILKTRAYF 11 AA PAT REGION 1..11 note neoantigen candidate (A2402) (Melanoma) source 1..11 mol_type protein organism synthetic construct STWNVHQQFLW 9 AA PAT REGION 1..9 note neoantigen candidate (A2402) (Melanoma) source 1..9 mol_type protein organism synthetic construct FYWTFVNAF 11 AA PAT REGION 1..11 note neoantigen candidate (A2402) (Melanoma) source 1..11 mol_type protein organism synthetic construct STWNVHQQFLW 9 AA PAT REGION 1..9 note neoantigen candidate (A2402) (Melanoma) source 1..9 mol_type protein organism synthetic construct FYWTFVNAF 11 AA PAT REGION 1..11 note neoantigen candidate (A2402) (Melanoma) source 1..11 mol_type protein organism synthetic construct STWNVHQQFLW 9 AA PAT REGION 1..9 note neoantigen candidate (A2402) (Melanoma) source 1..9 mol_type protein organism synthetic construct FYWTFVNAF 11 AA PAT REGION 1..11 note neoantigen candidate (A2402) (Melanoma) source 1..11 mol_type protein organism synthetic construct STWNVHQQFLW 9 AA PAT REGION 1..9 note neoantigen candidate (A2402) (Melanoma) source 1..9 mol_type protein organism synthetic construct FYWTFVNAF 11 AA PAT REGION 1..11 note neoantigen candidate (A2402) (Melanoma) source 1..11 mol_type protein organism synthetic construct STWNVHQQFLW 9 AA PAT REGION 1..9 note neoantigen candidate (A2402) (Melanoma) source 1..9 mol_type protein organism synthetic construct FYWTFVNAF 12 AA PAT REGION 1..12 note neoantigen candidate (A2402) (Melanoma) source 1..12 mol_type protein organism synthetic construct LYHFSDRMYSSW 10 AA PAT REGION 1..10 note neoantigen candidate (A1101) (Melanoma) source 1..10 mol_type protein organism synthetic construct STACFHPVTK 11 AA PAT REGION 1..11 note neoantigen candidate (A1101) (Melanoma) source 1..11 mol_type protein organism synthetic construct TTFGIQVRYLK 11 AA PAT REGION 1..11 note neoantigen candidate (A1101) (Melanoma) source 1..11 mol_type protein organism synthetic construct KIGDFGLATMK 11 AA PAT REGION 1..11 note neoantigen candidate (A1101) (Melanoma) source 1..11 mol_type protein organism synthetic construct KIGDFGLATEK 10 AA PAT REGION 1..10 note neoantigen candidate (A1101) (Melanoma) source 1..10 mol_type protein organism synthetic construct SSSGSINLLK 10 AA PAT REGION 1..10 note neoantigen candidate (A1101) (Melanoma) source 1..10 mol_type protein organism synthetic construct AVAVDFQFSK 9 AA PAT REGION 1..9 note neoantigen candidate (A1101) (Melanoma) source 1..9 mol_type protein organism synthetic construct KTAPVEWRK 10 AA PAT REGION 1..10 note neoantigen candidate (A1101) (Melanoma) source 1..10 mol_type protein organism synthetic construct STSYLQHREK 9 AA PAT REGION 1..9 note neoantigen candidate (A1101) (Melanoma) source 1..9 mol_type protein organism synthetic construct VAVDFQFSK 11 AA PAT REGION 1..11 note neoantigen candidate (A1101) (Melanoma) source 1..11 mol_type protein organism synthetic construct SAFTIQEYFVK 10 AA PAT REGION 1..10 note neoantigen candidate (A1101) (Melanoma) source 1..10 mol_type protein organism synthetic construct SVSNTTVGSK 9 AA PAT REGION 1..9 note neoantigen candidate (A1101) (Melanoma) source 1..9 mol_type protein organism synthetic construct RVQTGTIPK 9 AA PAT REGION 1..9 note neoantigen candidate (A1101) (Melanoma) source 1..9 mol_type protein organism synthetic construct SSGSINLLK 12 AA PAT REGION 1..12 note neoantigen candidate (A1101) (Melanoma) source 1..12 mol_type protein organism synthetic construct GTAAISVTGALK 11 AA PAT REGION 1..11 note neoantigen candidate (A1101) (Melanoma) source 1..11 mol_type protein organism synthetic construct STPNFSRLRRY 10 AA PAT REGION 1..10 note neoantigen candidate (A1101) (Melanoma) source 1..10 mol_type protein organism synthetic construct RSVLSSGYQK 10 AA PAT REGION 1..10 note neoantigen candidate (A1101) (Melanoma) source 1..10 mol_type protein organism synthetic construct VVSPVSLPRR 10 AA PAT REGION 1..10 note neoantigen candidate (A1101) (Melanoma) source 1..10 mol_type protein organism synthetic construct AAISVTGALK 10 AA PAT REGION 1..10 note neoantigen candidate (A1101) (Melanoma) source 1..10 mol_type protein organism synthetic construct GSQPPSLGRK 9 AA PAT REGION 1..9 note neoantigen candidate (A1101) (Melanoma) source 1..9 mol_type protein organism synthetic construct TVYCRYHNY 10 AA PAT REGION 1..10 note neoantigen candidate (MCF7-1) source 1..10 mol_type protein organism synthetic construct LLFDMTTHSV 9 AA PAT REGION 1..9 note neoantigen candidate (MCF7-2) source 1..9 mol_type protein organism synthetic construct FQSFFSLIV 10 AA PAT REGION 1..10 note neoantigen candidate (MCF7-3) source 1..10 mol_type protein organism synthetic construct FLGSGVHGGV 11 AA PAT REGION 1..11 note neoantigen candidate (MCF7-4) source 1..11 mol_type protein organism synthetic construct YLFFCGHMFHA 9 AA PAT REGION 1..9 note neoantigen candidate (MCF7-5) source 1..9 mol_type protein organism synthetic construct ITFEHILAL 9 AA PAT REGION 1..9 note neoantigen candidate (MCF7-6) source 1..9 mol_type protein organism synthetic construct NLANEITYI 9 AA PAT REGION 1..9 note neoantigen candidate (MCF7-7) source 1..9 mol_type protein organism synthetic construct VLCEPVHGL 10 AA PAT REGION 1..10 note neoantigen candidate (MCF7-8) source 1..10 mol_type protein organism synthetic construct MLLESLRHAV 11 AA PAT REGION 1..11 note neoantigen candidate (MCF7-9) source 1..11 mol_type protein organism synthetic construct SLFGLGFEEHV 10 AA PAT REGION 1..10 note neoantigen candidate (MCF7-10) source 1..10 mol_type protein organism synthetic construct HLLTDELGYV 9 AA PAT REGION 1..9 note neoantigen candidate (MCF7-11) source 1..9 mol_type protein organism synthetic construct KLSEASMIV 9 AA PAT REGION 1..9 note neoantigen candidate (MCF7-12) source 1..9 mol_type protein organism synthetic construct ALLDMRSLL 11 AA PAT REGION 1..11 note neoantigen candidate (MCF7-13) source 1..11 mol_type protein organism synthetic construct GLWEALTPCNV 9 AA PAT REGION 1..9 note neoantigen candidate (MCF7-14) source 1..9 mol_type protein organism synthetic construct SLARLHLTV 9 AA PAT REGION 1..9 note neoantigen candidate (MCF7-15) source 1..9 mol_type protein organism synthetic construct TLLPLPLLL 12 AA PAT REGION 1..12 note neoantigen candidate (MCF7-16) source 1..12 mol_type protein organism synthetic construct HLFWFADLNYRL 11 AA PAT REGION 1..11 note neoantigen candidate (MCF7-17) source 1..11 mol_type protein organism synthetic construct STMSFLRSLYL 9 AA PAT REGION 1..9 note neoantigen candidate (MCF7-18) source 1..9 mol_type protein organism synthetic construct TLNHEIYEA 12 AA PAT REGION 1..12 note neoantigen candidate (MCF7-19) source 1..12 mol_type protein organism synthetic construct ILWGSISFNLAV 9 AA PAT REGION 1..9 note neoantigen candidate (MCF7-20) source 1..9 mol_type protein organism synthetic construct MVCGAAFFI 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct MSLPFSFL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct ANFIFRQL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct STYKLTNL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct NMYGFRNV 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct VIYSHLQV 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct SGFRYNVL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct VVMEYENL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct IVHYFIAL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct VSFAPLVQL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct ATFYFHHPV 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct VHYLRLSL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct IGIFFQMRV 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct VAHVAAFL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct VFLRVRAL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct TIFMMLRL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct KGFLYSAL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct SSVLFKGL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct MQFYLRHL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct ARMMFSGL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct KSLYYASCL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct LVFVVGRL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct SIGVYIPL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct TVYRCGHL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct SLFTLHQSV 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct FTFVYPTI 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct CMLRYQTCL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct VCFDYTFAL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct LNVYYLPL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct VPYAVFPPL 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct VSFANAVV 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct VVPSFSAEI 10 AA PAT REGION 1..10 note neoantigen candidate (B16F10) source 1..10 mol_type protein organism synthetic construct CNFCYQRNQL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct QMYPAFKRV 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct ILVSTYRPL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct SFLAGFRPL 10 AA PAT REGION 1..10 note neoantigen candidate (B16F10) source 1..10 mol_type protein organism synthetic construct AIYHHASRAI 10 AA PAT REGION 1..10 note neoantigen candidate (B16F10) source 1..10 mol_type protein organism synthetic construct IAMGFPVERL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct VLILHAAAL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct SLVAPFGSV 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct MYRYFVTL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct VMMDNFDYL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct VTFQAFIDV 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct RAFAAVRL 12 AA PAT REGION 1..12 note neoantigen candidate (B16F10) source 1..12 mol_type protein organism synthetic construct KNFEFNKQRSIV 12 AA PAT REGION 1..12 note neoantigen candidate (B16F10) source 1..12 mol_type protein organism synthetic construct LMYVYEMLGAGL 10 AA PAT REGION 1..10 note neoantigen candidate (B16F10) source 1..10 mol_type protein organism synthetic construct CMLRYQTCLV 8 AA PAT REGION 1..8 note neoantigen candidate (B16F10) source 1..8 mol_type protein organism synthetic construct AIALHLHL 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct TSYSTAAPL 10 AA PAT REGION 1..10 note neoantigen candidate (B16F10) source 1..10 mol_type protein organism synthetic construct SMPHYSSPAI 9 AA PAT REGION 1..9 note neoantigen candidate (B16F10) source 1..9 mol_type protein organism synthetic construct TIPFYDNPI 9 AA PAT REGION 1..9 note mTRP2 source 1..9 mol_type protein organism synthetic construct SVYDFFVWL