JP 2023-16292 2023-02-06 SP100946SGA JP 2019-521018 2019-10-20 PEPTRON, INC. METHODS OF DELIVERING A NEUROPROTECTIVE POLYPEPTIDE TO THE CENTRAL NERVOUS SYSTEM 55 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 39 AA PAT REGION 1..39 note Description of Artificial Sequence: Note =Synthetic Construct source 1..39 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDLSSYLEGQAAKEFIAWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEGQAAKEFIAWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIEWLKNGG 31 AA PAT REGION 1..31 note Description of Artificial Sequence: Note =Synthetic Construct VARIANT 2 note Xaa= aminohexanoic acid source 1..31 mol_type protein organism synthetic construct HXAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 39 AA PAT REGION 1..39 note Description of Artificial Sequence: Note =Synthetic Construct VARIANT 30 note Xaa=any amino acid source 1..39 mol_type protein organism synthetic construct HAEGTFTSDVSSYLEGQAAKEFIAWLVKGXPSSGAPPPS 39 AA PAT REGION 1..39 note Description of Artificial Sequence: Note =Synthetic Construct source 1..39 mol_type protein organism synthetic construct HAEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HAEGTFTSDLSKQMEEEAVRLFIEWLKNGG 37 AA PAT REGION 1..37 note Description of Artificial Sequence: Note =Synthetic Construct source 1..37 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPP 35 AA PAT REGION 1..35 note Description of Artificial Sequence: Note =Synthetic Construct source 1..35 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGA 33 AA PAT REGION 1..33 note Description of Artificial Sequence: Note =Synthetic Construct source 1..33 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSS 28 AA PAT REGION 1..28 note Description of Artificial Sequence: Note =Synthetic Construct source 1..28 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIEWLKN 26 AA PAT REGION 1..26 note Description of Artificial Sequence: Note =Synthetic Construct source 1..26 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIEWL 23 AA PAT REGION 1..23 note Description of Artificial Sequence: Note =Synthetic Construct source 1..23 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Note =Synthetic Construct source 1..20 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVR 17 AA PAT REGION 1..17 note Description of Artificial Sequence: Note =Synthetic Construct source 1..17 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEE 14 AA PAT REGION 1..14 note Description of Artificial Sequence: Note =Synthetic Construct source 1..14 mol_type protein organism synthetic construct HGEGTFTSDLSKQM 11 AA PAT REGION 1..11 note Description of Artificial Sequence: Note =Synthetic Construct source 1..11 mol_type protein organism synthetic construct HGEGTFTSDLS 34 AA PAT REGION 1..34 note Description of Artificial Sequence: Note =Synthetic Construct VARIANT 3..6 note Xaa= aminohexanoic acid source 1..34 mol_type protein organism synthetic construct HAXXXXEGTFTSDVSSYLEGQAAKEFIAWLVKGR 38 AA PAT REGION 1..38 note Description of Artificial Sequence: Note =Synthetic Construct VARIANT 3..10 note Xaa=aminohexanoic acid source 1..38 mol_type protein organism synthetic construct HAXXXXXXXXEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDVSSYMEEQAVRLFIAWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDVSSYMEEQAAKEFIAWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDVSSYLEGQAVRLFIAWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDVSKYLEGQAAKEFIAWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDVSKYLEEEAAKEFIAWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDVSKYLEEEAAKEFIEWLVKGG 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDVSKYLEEEAAKEFIEWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIEWLKNGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIAWLKNGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVREFIAWLKNGR 39 AA PAT REGION 1..39 note Description of Artificial Sequence: Note =Synthetic Construct source 1..39 mol_type protein organism synthetic construct HGEGTFTSDVSSYLEGQAAKEFIAWLVKGGPSSGAPPPS 39 AA PAT REGION 1..39 note Description of Artificial Sequence: Note =Synthetic Construct source 1..39 mol_type protein organism synthetic construct HGEGTFTSDVSSYLEGQAAKEFIEWLKNGGPSSGAPPPS 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDVSSYLEEEAVRLFIAWLVKGR 30 AA PAT REGION 1..30 note Description of Artificial Sequence: Note =Synthetic Construct source 1..30 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEGQAAKEFIEWLKNGR 42 AA PAT REGION 1..42 note Description of Artificial Sequence: Note =Synthetic Construct source 1..42 mol_type protein organism synthetic construct YGEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ 39 AA PAT REGION 1..39 note Description of Artificial Sequence: Note =Synthetic Construct source 1..39 mol_type protein organism synthetic construct HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPS 42 AA PAT REGION 1..42 note Description of Artificial Sequence: Note =Synthetic Construct source 1..42 mol_type protein organism synthetic construct HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPSGAP 45 AA PAT REGION 1..45 note Description of Artificial Sequence: Note =Synthetic Construct source 1..45 mol_type protein organism synthetic construct HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPSGAPPSS 40 AA PAT REGION 1..40 note Description of Artificial Sequence: Note =Synthetic Construct VARIANT 2 note Xaa= aminohexanoic acid source 1..40 mol_type protein organism synthetic construct HXAEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPS 43 AA PAT REGION 1..43 note Description of Artificial Sequence: Note =Synthetic Construct VARIANT 2 note Xaa= aminohexanoic acid source 1..43 mol_type protein organism synthetic construct HXAEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPSGAP 46 AA PAT REGION 1..46 note Description of Artificial Sequence: Note =Synthetic Construct VARIANT 2 note Xaa= aminohexanoic acid source 1..46 mol_type protein organism synthetic construct HXAEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPSGAPPSS 40 AA PAT REGION 1..40 note Description of Artificial Sequence: Note =Synthetic Construct VARIANT 3 note Xaa= aminohexanoic acid source 1..40 mol_type protein organism synthetic construct HAXEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPS 43 AA PAT REGION 1..43 note Description of Artificial Sequence: Note =Synthetic Construct VARIANT 3 note Xaa= aminohexanoic acid source 1..43 mol_type protein organism synthetic construct HAXEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPSGAP 46 AA PAT REGION 1..46 note Description of Artificial Sequence: Note =Synthetic Construct VARIANT 3 note Xaa= aminohexanoic acid source 1..46 mol_type protein organism synthetic construct HAXEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPSGAPPSS 43 AA PAT REGION 1..43 note Description of Artificial Sequence: Note =Synthetic Construct VARIANT 2 note Xaa= aminohexanoic acid source 1..43 mol_type protein organism synthetic construct YXAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ 36 AA PAT REGION 1..36 note Description of Artificial Sequence: Note =Synthetic Construct source 1..36 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAP 39 AA PAT REGION 1..39 note Description of Artificial Sequence: Note =Synthetic Construct source 1..39 mol_type protein organism synthetic construct HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAPPPS 36 AA PAT REGION 1..36 note Description of Artificial Sequence: Note =Synthetic Construct source 1..36 mol_type protein organism synthetic construct HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSSGAP 33 AA PAT REGION 1..33 note Description of Artificial Sequence: Note =Synthetic Construct source 1..33 mol_type protein organism synthetic construct HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRPSS 39 AA PAT REGION 1..39 note amino acid sequence of Exendin-3 source 1..39 mol_type protein organism synthetic construct HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 31 AA PAT REGION 1..31 note amino acid sequence of Exendin-4 variant source 1..31 mol_type protein organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGP 39 AA PAT REGION 1..39 note amino acid sequence of 14Leu25Phe Exendin-4 variant source 1..39 mol_type protein organism synthetic construct HGEGTFTSDLSKQLEEEAVRLFIEFLKNGGPSSGAPPPS