US PCT/US2020/046782 2020-08-18 IMC-0003-WO US 62/899024 2019-09-11 IMCARE BIOTECH, LLC Xuanyong LU EPITOPES OF ANTI-SERINE PROTEASE INHIBITOR KAZAL (SPIK) ANTIBODIES 125 237 DNA PAT source 1..237 mol_type other DNA organism Homo sapiens atgaaggtaacaggcatctttcttctcagtgccttggccctgttgagtctatctggtaacactggagctgactccctgggaagagaggccaaatgttacaatgaacttaatggatgcaccaagatatatgaccctgtctgtgggactgatggaaatacttatcccaatgaatgcgtgttatgttttgaaaatcggaaacgccagacttctatcctcattcaaaaatctgggccttgc 79 AA PAT source 1..79 mol_type protein organism Homo sapiens MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC 168 DNA PAT source 1..168 mol_type other DNA organism Homo sapiens gactccctgggaagagaggccaaatgttacaatgaacttaatggatgcaccaagatatatgaccctgtctgtgggactgatggaaatacttatcccaatgaatgcgtgttatgttttgaaaatcggaaacgccagacttctatcctcattcaaaaatctgggccttgc 56 AA PAT source 1..56 mol_type protein organism Homo sapiens DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC 69 DNA PAT source 1..69 mol_type other DNA organism Homo sapiens atgaaggtaacaggcatctttcttctcagtgccttggccctgttgagtctatctggtaacactggagct 23 AA PAT source 1..23 mol_type protein organism Homo sapiens MKVTGIFLLSALALLSLSGNTGA 24 AA PAT source 1..24 mol_type protein organism Homo sapiens FLLSALALLSLSGNTGADSLGREA 11 AA PAT source 1..11 mol_type protein organism Homo sapiens CVLCFENRKRQ 9 AA PAT source 1..9 mol_type protein organism Homo sapiens LNGCTKIYD 11 AA PAT source 1..11 mol_type protein organism Homo sapiens NRKRQTSILIQ 17 AA PAT source 1..17 mol_type protein organism Homo sapiens FLLSALALLSLSGNTGA 4 AA PAT source 1..4 mol_type protein organism Homo sapiens LLSL 000 5 AA PAT source 1..5 mol_type protein organism Homo sapiens CVLCF 000 000 000 000 6 AA PAT REGION 1..6 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..6 mol_type protein organism synthetic construct SSNAIS 6 AA PAT REGION 1..6 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..6 mol_type protein organism synthetic construct SSYGVS 10 AA PAT REGION 1..10 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..10 mol_type protein organism synthetic construct GYTFTDYYIN 10 AA PAT REGION 1..10 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..10 mol_type protein organism synthetic construct GFTFSRYAMS 16 AA PAT REGION 1..16 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..16 mol_type protein organism synthetic construct AIGSSGSTYYASWAKS 16 AA PAT REGION 1..16 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..16 mol_type protein organism synthetic construct SIWSGGTTDYASWAKS 17 AA PAT REGION 1..17 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..17 mol_type protein organism synthetic construct WIYPGSGNPIYNENFKD 17 AA PAT REGION 1..17 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..17 mol_type protein organism synthetic construct SISIGGTYTYYPDSVKD 14 AA PAT REGION 1..14 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..14 mol_type protein organism synthetic construct RWENIGYTNVRLDL 12 AA PAT REGION 1..12 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..12 mol_type protein organism synthetic construct RGGYDYGYASNI 8 AA PAT REGION 1..8 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..8 mol_type protein organism synthetic construct EWGCAMDS 7 AA PAT REGION 1..7 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..7 mol_type protein organism synthetic construct EDYGFDY 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct QASQSISTALA 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct QASESISSYLS 17 AA PAT REGION 1..17 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..17 mol_type protein organism synthetic construct KSSQSLLNSGNQKNYLA 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct KASQDVSTAVA 7 AA PAT REGION 1..7 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..7 mol_type protein organism synthetic construct GASTLAS 7 AA PAT REGION 1..7 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..7 mol_type protein organism synthetic construct RASTLAS 7 AA PAT REGION 1..7 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..7 mol_type protein organism synthetic construct GASTRES 7 AA PAT REGION 1..7 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..7 mol_type protein organism synthetic construct WASTRHT 12 AA PAT REGION 1..12 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..12 mol_type protein organism synthetic construct QQGYSTSDVDNA 12 AA PAT REGION 1..12 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..12 mol_type protein organism synthetic construct QQGYSVSNVDNI 9 AA PAT REGION 1..9 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..9 mol_type protein organism synthetic construct QSDYSHPYT 8 AA PAT REGION 1..8 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..8 mol_type protein organism synthetic construct HQHYSTYT 6 AA PAT REGION 1..6 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..6 mol_type protein organism synthetic construct SYAISW 7 AA PAT REGION 1..7 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..7 mol_type protein organism synthetic construct SAYAISW 10 AA PAT REGION 1..10 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..10 mol_type protein organism synthetic construct GYTFTSYWMQ 10 AA PAT REGION 1..10 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..10 mol_type protein organism synthetic construct GYTFSSNWIE 16 AA PAT REGION 1..16 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..16 mol_type protein organism synthetic construct AINTYGGTYYASWAKS 16 AA PAT REGION 1..16 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..16 mol_type protein organism synthetic construct AINSGGSAYYANWAKS 17 AA PAT REGION 1..17 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..17 mol_type protein organism synthetic construct AIYPGDGDTRYTQKFED 17 AA PAT REGION 1..17 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..17 mol_type protein organism synthetic construct QIFPGRDTTNYNEKFKG 17 AA PAT REGION 1..17 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..17 mol_type protein organism synthetic construct RDFDSDAYTSASGGMDP 13 AA PAT REGION 1..13 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..13 mol_type protein organism synthetic construct REDIYDYGGAFDP 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct GANYANIRFAY 21 AA PAT REGION 1..21 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..21 mol_type protein organism synthetic construct RQEEFSDYYGSSHLYNYGMDY 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct QASQSINNYLS 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct QASQGISSYLS 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct RASQDITNYLN 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct RASQEISGHLS 7 AA PAT REGION 1..7 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..7 mol_type protein organism synthetic construct RASTLAS 7 AA PAT REGION 1..7 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..7 mol_type protein organism synthetic construct AATTLVS 7 AA PAT REGION 1..7 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..7 mol_type protein organism synthetic construct YTSRLHS 7 AA PAT REGION 1..7 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..7 mol_type protein organism synthetic construct AASILDS 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct QQGYTSNVDNV 12 AA PAT REGION 1..12 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..12 mol_type protein organism synthetic construct QQDYTTSNVDNT 9 AA PAT REGION 1..9 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..9 mol_type protein organism synthetic construct QQGNTVPWT 9 AA PAT REGION 1..9 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..9 mol_type protein organism synthetic construct LQYTDYPWT 120 AA PAT REGION 1..120 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..120 mol_type protein organism synthetic construct QGHLQQSGAELARPGTSVKLSCKASGYTFTSYWMQWVKQRPGQGLEWIGAIYPGDGDTRYTQKFEDKATLTADKSSSTAYMQLSNLASEDSAYYYCARGANYANIRFAYWGQGTLVTVSA 107 AA PAT REGION 1..107 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..107 mol_type protein organism synthetic construct DIQMTQTTSSLSASLGDRVSISCRASQDITNYLNWYQQKPDGTVKLLIFYTSRLHSGVPSRFSGSGSGTNFSLTISNLEQEDIATYFCQQGNTVPWTFGGGTKLEIK 130 AA PAT REGION 1..130 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..130 mol_type protein organism synthetic construct QVQLQQSGAELMKPGASVKISCKATGYTFSSNWIEWIKQRPGHGLEWIGQIFPGRDTTNYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARRQEEFSDYYGSSHLYNYGMDYWGQGTSVTVSS 107 AA PAT REGION 1..107 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..107 mol_type protein organism synthetic construct DIQMTQSPSSLSASLGERVSLTCRASQEISGHLSWLQQKPDGTIKRLIYAASILDSGVPKRFSGSRSGSDYSLTISNLESEDFADYYCLQYTDYPWTFGGGTKVEIK 152 AA PAT REGION 1..152 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..152 mol_type protein organism synthetic construct LVAVLKGVQCQSVKESEGGLFKPTDALTLTCTVSGFSLSSYAISWVRQAPGSGLEWIGAINTYGGTYYASWAKSRSTITRNTNENTVTLKMTSLTAADTATYFCARDFDSDAYTSASGGMDWGPGTLVTVSSGQPKAPSFFPLAPCCGDTPR 132 AA PAT REGION 1..132 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..132 mol_type protein organism synthetic construct WLPGARCAYDMTQTPASVEVAVGGTVTIKCQASQSINNYLSWYQQIPGQPPKLLIYRASTLASGVSSRFKGSGSGTQFTLTISGVQCADAATYYCQQGYTSNVDNVFGGGTEVVVKGDPVAPTVLIFPPSAD 136 AA PAT REGION 1..136 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..136 mol_type protein organism synthetic construct LVAVLKGVQCQSVKESEGGLFKPTDTLTLTCTVSGFSLSAYAISWVRQAPGNGLEWIGAINSGGSAYYANWAKSRSTITRNTNLNTVTLKMTSLTAADTATYFCAREDIYDYGGAFDPWGPGTLVTVSTGQPKLHH 133 AA PAT REGION 1..133 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..133 mol_type protein organism synthetic construct WLPGARCAYDMTQTPASVEVTVGGTVTIKCQASQGISSYLSWYQQKPGQPPKLLIYAATTLVSGVSSRFKGSGSGTQFTLTISGVECADAATYYCQQDYTTSNVDNTFGGGTEVVVKGDPVAPTVLIFPPSAD 130 AA PAT REGION 1..130 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..130 mol_type protein organism synthetic construct QIQLQQSGPELVKPGTSVKLSCKASGYTFTDYYINWVKQRPGQGLEWIGWIYPGSGNPIYNENFKDKATLTVDTSSTTAYLQLSSLTSEDSAVYFCAREWGCAMDSWGQGTSVTVSSAKTTAPSVYPLAP 113 AA PAT REGION 1..113 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..113 mol_type protein organism synthetic construct DIVMTQSPSSLSVSTGEKVTMSCKSSQSLLNSGNQKNYLAWYQQKPGQSPKLLIYGASTRESGVPDRFTGSGSGTEFTLTISSVQAEDLAVYYCQSDYSHPYTFGGGTKLEIK 135 AA PAT REGION 1..135 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..135 mol_type protein organism synthetic construct MNFVLSLIFLALILKGVQCEVQLVESGGGLVKPGRSLKLSCAASGFTFSRYAMSWVRQTPEKRLEGVASISIGGTYTYYPDSVKDRFTISRDNAKNTLYLQMNSLRSEDTAMYYCVREDYGFDYWGQGTLVTVSS 106 AA PAT REGION 1..106 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..106 mol_type protein organism synthetic construct DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTISSVQAEDLALYYCHQHYSTYTFGGGTKLEIK 151 AA PAT REGION 1..151 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..151 mol_type protein organism synthetic construct LVAVLKGVQCQSVKESEGGLFKPTDTLTLTCTVSGFSLSSNAISWVRQAPGNGLEWIGAIGSSGSTYYASWAKSRSTVTRNTNLNTVTLKMTSLTAADTATYFCARWENIGYTNVRLDLWGQGTLVTVSSGQPKAPSVFPLAPCCGDTPSS 114 AA PAT REGION 1..114 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..114 mol_type protein organism synthetic construct WLPGARCAYDMTQTPASVEVAVGGTVTIKCQASQSISTALAWYQQKPGQPPKLLIYGASTLASGVSSRFKGSGSGTQFTLTISGVECADAATYYCQQGYSTSDVDNAFGGGTEG 135 AA PAT REGION 1..135 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..135 mol_type protein organism synthetic construct LVAVLKGVQCQSVKESEGGLFKPTDTLTLTCTVSGFSLSSYGVSWVRQAPGKGLEWIGSIWSGGTTDYASWAKSRSTITRNTNENTVTLKVTSLTAADTATYFCARGGYDYGYASNIWGPGTLVTVSSGQPKAPS 134 AA PAT REGION 1..134 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..134 mol_type protein organism synthetic construct LWLPGARCAYDMTQTPASVEVAVGGTVTIKCQASESISSYLSWYQQKPGQPPKLLIYRASTLASGVPSRFSGSGSGTEFTLTISDGQCDDAATYYCQQGYSVSNVDNIFGGGTEVVVKGDPVAPTVLIFPPSAD 15 AA PAT REGION 1..15 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..15 mol_type protein organism synthetic construct GGGGSGGGGSGGGGS 12 AA PAT source 1..12 mol_type protein organism Homo sapiens ELNGCTKIYDPV 5 AA PAT source 1..5 mol_type protein organism Homo sapiens KVTGI 79 AA PAT REGION 1..79 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..79 mol_type protein organism synthetic construct MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC 51 AA PAT REGION 1..51 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..51 mol_type protein organism synthetic construct MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDG 28 AA PAT REGION 1..28 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..28 mol_type protein organism synthetic construct DSLGREAKCYNELNGCTKIYDPVCGTDG 28 AA PAT REGION 1..28 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..28 mol_type protein organism synthetic construct NTYPNECVLCFENRKRQTSILIQKSGPC 21 AA PAT REGION 1..21 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..21 mol_type protein organism synthetic construct SALALLSLSGNTGADSLGREA 9 AA PAT REGION 1..9 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..9 mol_type protein organism synthetic construct GNTGADSLG 9 AA PAT REGION 1..9 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..9 mol_type protein organism synthetic construct SGNTGADSL 9 AA PAT REGION 1..9 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..9 mol_type protein organism synthetic construct LSGNTGADS 9 AA PAT REGION 1..9 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..9 mol_type protein organism synthetic construct SLSGNTGAD 9 AA PAT REGION 1..9 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..9 mol_type protein organism synthetic construct LSLSGNTGA 13 AA PAT REGION 1..13 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..13 mol_type protein organism synthetic construct LLSLSGNTGADSL 13 AA PAT REGION 1..13 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..13 mol_type protein organism synthetic construct SLSGNTGADSLGR 13 AA PAT REGION 1..13 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..13 mol_type protein organism synthetic construct SGNTGADSLGREA 10 AA PAT REGION 1..10 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..10 mol_type protein organism synthetic construct ALLSLSGNTG 10 AA PAT REGION 1..10 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..10 mol_type protein organism synthetic construct SALALLSLSG 10 AA PAT REGION 1..10 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..10 mol_type protein organism synthetic construct DLVPRGSPGI 10 AA PAT REGION 1..10 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..10 mol_type protein organism synthetic construct GLVPRGSPGI 10 AA PAT REGION 1..10 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..10 mol_type protein organism synthetic construct LEDPGYRGRT 26 AA PAT REGION 1..26 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..26 mol_type protein organism synthetic construct GIFLLSALALLSLSGNTGADSLGREA 14 AA PAT REGION 1..14 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..14 mol_type protein organism synthetic construct SLSGNTGADSLGRE 15 AA PAT REGION 1..15 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..15 mol_type protein organism synthetic construct LLSLSGNTGADSLGR 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct GIFLLSALALL 9 AA PAT REGION 1..9 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..9 mol_type protein organism synthetic construct FLLSALALL 19 AA PAT REGION 1..19 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..19 mol_type protein organism synthetic construct DGNTYPNECVLCFENRKRQ 12 AA PAT REGION 1..12 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..12 mol_type protein organism synthetic construct DGNTYPNECVLC 19 AA PAT REGION 1..19 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..19 mol_type protein organism synthetic construct GNTYPNECVLCFENRKRQE 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct CVLCFENRKRQ 9 AA PAT REGION 1..9 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..9 mol_type protein organism synthetic construct LCFENRKRQ 17 AA PAT REGION 1..17 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..17 mol_type protein organism synthetic construct KCYNELNGCTKIYDPVC 14 AA PAT REGION 1..14 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..14 mol_type protein organism synthetic construct KCYNELNGCTKIYD 13 AA PAT REGION 1..13 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..13 mol_type protein organism synthetic construct KCYNELNGCTKIY 8 AA PAT REGION 1..8 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..8 mol_type protein organism synthetic construct NGCTKIYD 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct LNGCTKIYDPV 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct CTKIYDPVCGT 30 AA PAT REGION 1..30 note source = /note="Description of Artificial Sequence: Syntheticpolypeptide" source 1..30 mol_type protein organism synthetic construct DGNTYPNECVLCFENRKRQTSILIQKSGPC 10 AA PAT REGION 1..10 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..10 mol_type protein organism synthetic construct GNTYPNECVL 15 AA PAT REGION 1..15 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..15 mol_type protein organism synthetic construct NRKRQTSILIQKSGP 10 AA PAT REGION 1..10 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..10 mol_type protein organism synthetic construct RKRQTSILIQ 11 AA PAT REGION 1..11 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..11 mol_type protein organism synthetic construct NRKRQTSILIQ 13 AA PAT REGION 1..13 note source = /note="Description of Artificial Sequence: Syntheticpeptide" source 1..13 mol_type protein organism synthetic construct CFENRKRQTSILI