206085-0121-00WO US 63/241,274 2021-09-07 MUSC Foundation for Research Development Carol Feghali-Bostwick Endostatin Peptides for the Treatment of Tumors, Fibrosis and Acute Lung Injury 27 9 AA PAT source 1..9 mol_type protein organism synthetic construct ATGQASSLL 36 AA PAT source 1..36 mol_type protein organism synthetic construct SYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHA 48 AA PAT source 1..48 mol_type protein organism synthetic construct SYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMT 24 AA PAT source 1..24 mol_type protein organism synthetic construct ATGQASSLLGGRLLGQSAASCHHA 16 AA PAT source 1..16 mol_type protein organism synthetic construct ATGQASSLLGGRLLGQ 21 AA PAT source 1..21 mol_type protein organism synthetic construct SYCETWRTEAPSATGQASSLL 28 AA PAT source 1..28 mol_type protein organism synthetic construct SYCETWRTEAPSATGQASSLLGGRLLGQ 36 AA PAT source 1..36 mol_type protein organism synthetic construct MOD_RES 1 note N-Biotinylated MOD_RES 36 note AMIDATION SYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHA 36 AA PAT source 1..36 mol_type protein organism synthetic construct MOD_RES 36 note AMIDATION SYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHA 34 AA PAT source 1..34 mol_type protein organism synthetic construct MOD_RES 34 note AMIDATION CETWRTEAPSATGQASSLLGGRLLGQSAASCHHA 31 AA PAT source 1..31 mol_type protein organism synthetic construct MOD_RES 31 note AMIDATION WRTEAPSATGQASSLLGGRLLGQSAASCHHA 23 AA PAT source 1..23 mol_type protein organism synthetic construct CETWRTEAPSATGQASSLLGGRL 21 AA PAT source 1..21 mol_type protein organism synthetic construct WRTEAPSATGQASSLLGGRLL 20 AA PAT source 1..20 mol_type protein organism synthetic construct WRTEAPSATGQASSLLGGRL 19 AA PAT source 1..19 mol_type protein organism synthetic construct CETWRTEAPSATGQASSLL 20 AA PAT source 1..20 mol_type protein organism synthetic construct MOD_RES 20 note AMIDATION ASSLLGGRLLGQSAASCHHA 18 AA PAT source 1..18 mol_type protein organism synthetic construct CETWRTEAPSATGQASSL 19 AA PAT source 1..19 mol_type protein organism synthetic construct MOD_RES 19 note AMIDATION SSLLGGRLLGQSAASCHHA 18 AA PAT source 1..18 mol_type protein organism synthetic construct MOD_RES 18 note AMIDATION SLLGGRLLGQSAASCHHA 17 AA PAT source 1..17 mol_type protein organism synthetic construct MOD_RES 17 note AMIDATION LLGGRLLGQSAASCHHA 16 AA PAT source 1..16 mol_type protein organism synthetic construct WRTEAPSATGQASSLL 16 AA PAT source 1..16 mol_type protein organism synthetic construct TWRTEAPSATGQASSL 16 AA PAT source 1..16 mol_type protein organism synthetic construct LGGRLLGQSAASCHHA 16 AA PAT source 1..16 mol_type protein organism synthetic construct MOD_RES 16 note AMIDATION LGGRLLGQSAASCHHA 15 AA PAT source 1..15 mol_type protein organism synthetic construct WRTEAPSATGQASSL 15 AA PAT source 1..15 mol_type protein organism synthetic construct MOD_RES 15 note AMIDATION GGRLLGQSAASCHHA 14 AA PAT source 1..14 mol_type protein organism synthetic construct MOD_RES 14 note AMIDATION GRLLGQSAASCHHA