38120-3629WO (11110WO01) US 63/292,581 2021-12-22 Regeneron Pharmaceuticals, Inc. Treatment Of Kidney Diseases With Angiopoietin Like 3 (ANGPTL3) Inhibitors 1367 369 DNA PAT misc_feature 1..369 note Synthetic source 1..369 mol_type other DNA organism synthetic construct caggtgcagctggtggagtctgggggaggcgtggtccagcctgggaggtccctgagactctcctgtgcagcctctggattcaccttcagtagttatggcatgcactgggtccgccaggctccaggcaaggggctggagtgggtggcagttatatcatatgatggaagtaataaatactatgcagactccgtgaagggccgattcaccatttccagagacaattccaagaacacgctgtatctgcaaatgaacagcctgagagctgaggacacggctgtgtattactgtgcgaaagtgggagctactactttctactactactacggtatggacgtctggggccaagggaccacggtcaccgtctcctca 123 AA PAT REGION 1..123 note Synthetic source 1..123 mol_type protein organism synthetic construct QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVGATTFYYYYGMDVWGQGTTVTVSS 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct ggattcaccttcagtagttatggc 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct GFTFSSYG 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct atatcatatgatggaagtaataaa 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct ISYDGSNK 48 DNA PAT misc_feature 1..48 note Synthetic source 1..48 mol_type other DNA organism synthetic construct gcgaaagtgggagctactactttctactactactacggtatggacgtc 16 AA PAT REGION 1..16 note Synthetic source 1..16 mol_type protein organism synthetic construct AKVGATTFYYYYGMDV 321 DNA PAT misc_feature 1..321 note Synthetic source 1..321 mol_type other DNA organism synthetic construct gacatccagatgacccagtctccatcttccgtgtctgcatttgtaggagacagagtcaccatcacttgtcgggcgagtcagggtattagcagctggttagcctggtatcagcagaaaccagggaaagcccctaagctcctgatctatgctgcatccagtttgcaaagtggggtcccatcaaggttcagcggcagtggatctgggacagatttcactctcaccatcagcagcctgcagcctgaagattttgcaacttactattgtcaaaaggctaacagtttcccattcactttcggccctgggaccaaagtggatatcaaa 107 AA PAT REGION 1..107 note Synthetic source 1..107 mol_type protein organism synthetic construct DIQMTQSPSSVSAFVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQKANSFPFTFGPGTKVEIK 18 DNA PAT misc_feature 1..18 note Synthetic source 1..18 mol_type other DNA organism synthetic construct cagggtattagcagctgg 6 AA PAT REGION 1..6 note Synthetic source 1..6 mol_type protein organism synthetic construct QGISSW 000 000 27 DNA PAT misc_feature 1..27 note Synthetic source 1..27 mol_type other DNA organism synthetic construct caaaaggctaacagtttcccattcact 9 AA PAT REGION 1..9 note Synthetic source 1..9 mol_type protein organism synthetic construct QKANSFPFT 369 DNA PAT misc_feature 1..369 note Synthetic source 1..369 mol_type other DNA organism synthetic construct caggtgcagctggtggagtctgggggaggcgtggtccagcctgggaggtccctgagactctcctgtgcagcctctggattcaccttcagtagctatggcatgcactgggtccgccaggctccaggcaaggggctggagtgggtggcagttatatcaaatgatggaagtaataaatactatgtagattccgtgaagggccgattcaccatgggcagagacaattccaagaacacgctgtatctccaaatgaacagcctgagagttgaggacacggctgtgtattactgtgcgaaaggggctggaactctttactactactactacggtatggacgtctggggccaagggaccacggtcaccgtctcctca 123 AA PAT REGION 1..123 note Synthetic source 1..123 mol_type protein organism synthetic construct QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISNDGSNKYYVDSVKGRFTMGRDNSKNTLYLQMNSLRVEDTAVYYCAKGAGTLYYYYYGMDVWGQGTTVTVSS 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct ggattcaccttcagtagctatggc 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct GFTFSSYG 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct atatcaaatgatggaagtaataaa 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct ISNDGSNK 48 DNA PAT misc_feature 1..48 note Synthetic source 1..48 mol_type other DNA organism synthetic construct gcgaaaggggctggaactctttactactactactacggtatggacgtc 16 AA PAT REGION 1..16 note Synthetic source 1..16 mol_type protein organism synthetic construct AKGAGTLYYYYYGMDV 321 DNA PAT misc_feature 1..321 note Synthetic source 1..321 mol_type other DNA organism synthetic construct gacatccagatgacccagtctccttccaccctgtctgcatctgtaggaaacagagtcaccatcacttgccgggccagtcaaagtattagtagctggttggcctggtatcaacaaaaaccagggaaagcccctaagttcctgatctataaggcgtctagtttagaaagtggggtcccatcaaggttcagcggcagtggatctgggacagaattcactctcaccatcaccagcctgcagcctgatgattttgcaacttattactgccaacagtacaatatttattcgtggacgttcggccaagggaccaaggtggaaatcaaa 107 AA PAT REGION 1..107 note Synthetic source 1..107 mol_type protein organism synthetic construct DIQMTQSPSTLSASVGNRVTITCRASQSISSWLAWYQQKPGKAPKFLIYKASSLESGVPSRFSGSGSGTEFTLTITSLQPDDFATYYCQQYNIYSWTFGQGTKVEIK 18 DNA PAT misc_feature 1..18 note Synthetic source 1..18 mol_type other DNA organism synthetic construct caaagtattagtagctgg 6 AA PAT REGION 1..6 note Synthetic source 1..6 mol_type protein organism synthetic construct QSISSW 000 000 27 DNA PAT misc_feature 1..27 note Synthetic source 1..27 mol_type other DNA organism synthetic construct caacagtacaatatttattcgtggacg 9 AA PAT REGION 1..9 note Synthetic source 1..9 mol_type protein organism synthetic construct QQYNIYSWT 372 DNA PAT misc_feature 1..372 note Synthetic source 1..372 mol_type other DNA organism synthetic construct caggtgcagctggtggagtctgggggaggcgtggtccagcctgggaggtccctgagactctcctgtgcagcctctggattcaccttcagtacctatggcatgcactgggtccgccaggctccaggcaaggggctggagtggatggcagttatatcatttgatagaggtaataaatactatgcagactccgtgaagggccgattcaccatctccagagacaattccaagaacacgctgtatctgcaaatgaacagcctgagagctgaggacacggctgtgtattactgtgcgaaaggggggggttcggggactttctactactactacggtatggacgtctggggccaagggaccacggtcaccgtctcctca 124 AA PAT REGION 1..124 note Synthetic source 1..124 mol_type protein organism synthetic construct QVQLVQSGGGVVQPGRSLRLSCAASGFTFSTYGMHWVRQAPGKGLEWMAVISFDRGNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGGGSGTFYYYYGMDVWGQGTTVTVSS 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct ggattcaccttcagtacctatggc 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct GFTFSTYG 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct atatcatttgatagaggtaataaa 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct ISFDRGNK 51 DNA PAT misc_feature 1..51 note Synthetic source 1..51 mol_type other DNA organism synthetic construct gcgaaaggggggggttcggggactttctactactactacggtatggacgtc 17 AA PAT REGION 1..17 note Synthetic source 1..17 mol_type protein organism synthetic construct AKGGGSGTFYYYYGMDV 324 DNA PAT misc_feature 1..324 note Synthetic source 1..324 mol_type other DNA organism synthetic construct gacatccagatgacccagtctccatcttccgtgtctgcatctgtaggaaacagagtcaccatcacttgtcgggcgagtcagggtattagcagctggttagcctggtatcaccagaaaccagggaaagtccctaaggtcctgatctatgctgcatccagtttgcaaagtggggtcccatcaaggttcagcggcagtggatctgggacagatttcactctcaccatcagcagcctgcagcctgaagattttgcaacttactattgtcaacaggctaacagtttcccattcactttcggccctgggaccaaagtggatatcaaacga 108 AA PAT REGION 1..108 note Synthetic source 1..108 mol_type protein organism synthetic construct DIQMTQSPSSVSASVGNRVTITCRASQGISSWLAWYHQKPGKVPKVLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFPFTFGPGTKVEIKR 18 DNA PAT misc_feature 1..18 note Synthetic source 1..18 mol_type other DNA organism synthetic construct cagggtattagcagctgg 6 AA PAT REGION 1..6 note Synthetic source 1..6 mol_type protein organism synthetic construct QGISSW 000 000 27 DNA PAT misc_feature 1..27 note Synthetic source 1..27 mol_type other DNA organism synthetic construct caacaggctaacagtttcccattcact 9 AA PAT REGION 1..9 note Synthetic source 1..9 mol_type protein organism synthetic construct QQANSFPFT 375 DNA PAT misc_feature 1..375 note Synthetic source 1..375 mol_type other DNA organism synthetic construct caggtacagctgcagcagtcaggtccaggactggtgaaaccctcgcagaccctctcactcacctgtgccatctccggggacagtgtctctagcaacagtcctgcttggaactggatcaggcagtccccatcgagaggccttgagtggctgggaaggacatactacaggtccaagtggtataatgattatgcagtgtctgtgagaggtcgaataaccatcaacccagacacatccaataaccagttctccctacatctgaactctgtgactcccgaggacacggcgatgtattactgtgcaagagacaagggtctaacagctcgtccgacctactttgactactggggccagggaaccctggtcaccgtctcctca 125 AA PAT REGION 1..125 note Synthetic source 1..125 mol_type protein organism synthetic construct QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSPAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVRGRITINPDTSNNQFSLHLNSVTPEDTAMYYCARDKGLTARPTYFDYWGQGTLVTVSS 30 DNA PAT misc_feature 1..30 note Synthetic source 1..30 mol_type other DNA organism synthetic construct ggggacagtgtctctagcaacagtcctgct 10 AA PAT REGION 1..10 note Synthetic source 1..10 mol_type protein organism synthetic construct GDSVSSNSPA 27 DNA PAT misc_feature 1..27 note Synthetic source 1..27 mol_type other DNA organism synthetic construct acatactacaggtccaagtggtataat 9 AA PAT REGION 1..9 note Synthetic source 1..9 mol_type protein organism synthetic construct TYYRSKWYN 45 DNA PAT misc_feature 1..45 note Synthetic source 1..45 mol_type other DNA organism synthetic construct gcaagagacaagggtctaacagctcgtccgacctactttgactac 15 AA PAT REGION 1..15 note Synthetic source 1..15 mol_type protein organism synthetic construct ARDKGLTARPTYFDY 326 DNA PAT misc_feature 1..326 note Synthetic source 1..326 mol_type other DNA organism synthetic construct gacatccagatgacccagtctccttccaccctgtctgcatctgtaggagacagagtcaccatcacttgccgggccagtcagagtattaattactggttggcctggtatcagcagaaaccagggaaagcccctaagccccttatctataaggcgtctagtttagaaagtggggtcccatcaaggttcagcggcagtggatctgggacagagttcactctcaccatcagcagcctgcagcctgacgattttacaacttattactgccaacagtataatagttattctccgacgttcggccaagggaccaaggtggaaatcaaacgaac 108 AA PAT REGION 1..108 note Synthetic source 1..108 mol_type protein organism synthetic construct DIQMTQSPSTLSASVGDRVTITCRASQSINYWLAWYQQKPGKAPKPLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFTTYYCQQYNSYSPTFGQGTKLEIKR 18 DNA PAT misc_feature 1..18 note Synthetic source 1..18 mol_type other DNA organism synthetic construct cagagtattaattactgg 6 AA PAT REGION 1..6 note Synthetic source 1..6 mol_type protein organism synthetic construct QSINYW 000 000 27 DNA PAT misc_feature 1..27 note Synthetic source 1..27 mol_type other DNA organism synthetic construct caacagtataatagttattctccgacg 9 AA PAT REGION 1..9 note Synthetic source 1..9 mol_type protein organism synthetic construct QQYNSYSPT 378 DNA PAT misc_feature 1..378 note Synthetic source 1..378 mol_type other DNA organism synthetic construct gaggtgcagctggtggagtctgggggaggcgtgatacagcctggggggtccctgagactctcctgtgcagcctctggattcaccttcgatgattatgccatgaactgggtccgtcaaggtccagggaagggtctggagtgggtctctgccataagtggtgatggcggtagcacatactatgcagactcggtgaagggccgattcaccatctccagagacaacagcaaaaactccctgtatctgcaaatgaacagtctgagagctgaggacaccgcctttttttactgtgcaaaagatctccgtaatacgatttttggagtggttattcccgatgcttttgatatctggggccaagggacaatggtcaccgtctcttca 126 AA PAT REGION 1..126 note Synthetic source 1..126 mol_type protein organism synthetic construct EVQLVESGGGVIQPGGSLRLSCAASGFTFDDYAMNWVRQGPGKGLEWVSAISGDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTAFFYCAKDLRNTIFGVVIPDAFDIWGQGTMVTVSS 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct ggattcaccttcgatgattatgcc 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct GFTFDDYA 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct ataagtggtgatggcggtagcaca 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct ISGDGGST 57 DNA PAT misc_feature 1..57 note Synthetic source 1..57 mol_type other DNA organism synthetic construct gcaaaagatctccgtaatacgatttttggagtggttattcccgatgcttttgatatc 19 AA PAT REGION 1..19 note Synthetic source 1..19 mol_type protein organism synthetic construct AKDLRNTIFGVVIPDAFDI 324 DNA PAT misc_feature 1..324 note Synthetic source 1..324 mol_type other DNA organism synthetic construct gacatccagatgacccagtctccttccaccctgtctgcatctgtaggagacagagtcaccatcacttgccgggccagtcagagcattaggagctggttggcctggtatcagcagaaaccagggaaagcccctaaactcctgatctataaggcgtctagtttagaaagtggggtcccatcaaggttcagcggcagtggatctgggacagaattcactctcaccatcagcagcctgcagcctgatgattttgcaacttattactgccaacaatataatagttattcgtacacttttggccaggggaccaagctggagatcaaacga 108 AA PAT REGION 1..108 note Synthetic source 1..108 mol_type protein organism synthetic construct DIQMTQSPSTLSASVGDRVTITCRASQSIRSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYSYTFGQGTKLEIKR 18 DNA PAT misc_feature 1..18 note Synthetic source 1..18 mol_type other DNA organism synthetic construct cagagcattaggagctgg 6 AA PAT REGION 1..6 note Synthetic source 1..6 mol_type protein organism synthetic construct QSIRSW 000 000 27 DNA PAT misc_feature 1..27 note Synthetic source 1..27 mol_type other DNA organism synthetic construct caacaatataatagttattcgtacact 9 AA PAT REGION 1..9 note Synthetic source 1..9 mol_type protein organism synthetic construct QQYNSYSYT 354 DNA PAT misc_feature 1..354 note Synthetic source 1..354 mol_type other DNA organism synthetic construct caggtgcagctggtggagtcggggggaggcttggtcaagcctggagggtccctgagactctcctgtgcagcctctggattcactttcagtgactactacatgagctggatccgtcaggctccagggaaggggctggagtgggtttcatacattggtagtagtggtgtcaacatgtactacgcagactctgtgaagggccgattcaccatctccagggacaacgccaagaattcattatatctggaaatgaacagcctgagagccgaggacacggctgtttattactgtgcgagagactcttcccaactgggttttgactactggggccagggaaccctggtcaccgtctcctca 118 AA PAT REGION 1..118 note Synthetic source 1..118 mol_type protein organism synthetic construct QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYIGSSGVNMYYADSVKGRFTISRDNAKNSLYLEMNSLRAEDTAVYYCARDSSQLGFDYWGQGTLVTVSS 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct ggattcactttcagtgactactac 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct GFTFSDYY 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct attggtagtagtggtgtcaacatg 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct IGSSGVNM 33 DNA PAT misc_feature 1..33 note Synthetic source 1..33 mol_type other DNA organism synthetic construct gcgagagactcttcccaactgggttttgactac 11 AA PAT REGION 1..11 note Synthetic source 1..11 mol_type protein organism synthetic construct ARDSSQLGFDY 324 DNA PAT misc_feature 1..324 note Synthetic source 1..324 mol_type other DNA organism synthetic construct gacatccagatgacccagtctccatcctccctgtctgcatctgtaggagacagagtcaccatcacttgccggacaagtcagaatattatcaactttttaaattggtatcaacagaaacctgggaaggcccctaaactcctgatctatactacttccactttacaaagtggggtcccatcaaggttcagtggcagtggatctgggacagatttcactctctccatcaatagtctacaacctgaagattttgcaacttacttctgtcaacagacttacagtaatccactcactttcggcggagggaccaaggtggagatcaaacga 108 AA PAT REGION 1..108 note Synthetic source 1..108 mol_type protein organism synthetic construct DIQMTQSPSSLSASVGDRVTITCRTSQNIINFLNWYQQKPGKAPKLLIYTTSTLQSGVPSRFSGSGSGTDFTLSINSLQPEDFATYFCQQTYSNPLTFGGGTKLEIKR 18 DNA PAT misc_feature 1..18 note Synthetic source 1..18 mol_type other DNA organism synthetic construct cagaatattatcaacttt 6 AA PAT REGION 1..6 note Synthetic source 1..6 mol_type protein organism synthetic construct QNIINF 000 000 27 DNA PAT misc_feature 1..27 note Synthetic source 1..27 mol_type other DNA organism synthetic construct caacagacttacagtaatccactcact 9 AA PAT REGION 1..9 note Synthetic source 1..9 mol_type protein organism synthetic construct QQTYSNPLT 360 DNA PAT misc_feature 1..360 note Synthetic source 1..360 mol_type other DNA organism synthetic construct gaggtgcagctggtgcagtctgggggaggcgtggtccagcctgggaggtccctgagactctcctgtgcagcgtctggattcaccttcagtaattatggcatgcactgggtccgccaggctccaggcaaggggctggagtgggtggcagttgtttggtatgatggagataataaatactatgcagactccgtgaagggccgattcaccatctccagagacaattccaagaacacgctgtatctgcaaatgaacagcctgagagccgaggacacggctgtgtattactgtgcgagagatattatcacatctcgcccgactttggactactggggccagggaaccctggtcactgtctcctca 120 AA PAT REGION 1..120 note Synthetic source 1..120 mol_type protein organism synthetic construct EVQLVQSGGGVVQPGRSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAVVWYDGDNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDIITSRPTLDYWGQGTLVTVSS 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct ggattcaccttcagtaattatggc 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct GFTFSNYG 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct gtttggtatgatggagataataaa 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct VWYDGDNK 39 DNA PAT misc_feature 1..39 note Synthetic source 1..39 mol_type other DNA organism synthetic construct gcgagagatattatcacatctcgcccgactttggactac 13 AA PAT REGION 1..13 note Synthetic source 1..13 mol_type protein organism synthetic construct ARDIITSRPTLDY 324 DNA PAT misc_feature 1..324 note Synthetic source 1..324 mol_type other DNA organism synthetic construct gacatccagttgacccagtctccatccttcctgtctgcatctgtaggagacagagtcaccatcacttgctgggccagtcagggcattaacagttatttagcctggtatcagcaaaaaccagggaaagcccctaagctcctgatctatcctgcatccactttgcaaagtggggtcccatcaaggttcagcggcagtggatctgggacagaattcactctcacaatcagcagcctgcagcctgtagattttgcaacttattactgtcaacagcttaatagttacccgctcactttcggcggagggaccaaggtggagatcaaacga 108 AA PAT REGION 1..108 note Synthetic source 1..108 mol_type protein organism synthetic construct DIQLTQSPSFLSASVGDRVTITCWASQGINSYLAWYQQKPGKAPKLLIYPASTLQSGVPSRFSGSGSGTEFTLTISSLQPVDFATYYCQQLNSYPLTFGGGTKVEIKR 18 DNA PAT misc_feature 1..18 note Synthetic source 1..18 mol_type other DNA organism synthetic construct cagggcattaacagttat 6 AA PAT REGION 1..6 note Synthetic source 1..6 mol_type protein organism synthetic construct QGINSY 000 000 27 DNA PAT misc_feature 1..27 note Synthetic source 1..27 mol_type other DNA organism synthetic construct caacagcttaatagttacccgctcact 9 AA PAT REGION 1..9 note Synthetic source 1..9 mol_type protein organism synthetic construct QQLNSYPLT 354 DNA PAT misc_feature 1..354 note Synthetic source 1..354 mol_type other DNA organism synthetic construct caggtgcagctggtggagtcggggggaggcttggtcaagcctggagggtccctgagactctcctgtgcagcctctggattcaccttcagtgactactacatgagctggatccgccaggctccagggaaggggctggagtgggtttcatacattagtagtagtggtagtaccatatactacgcagactctgtgaagggccgattcaccatatccagggacaacgccaagaactcactgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcgagagattcttcccaactgggttttgactactggggccagggaaccctggtcaccgtctcctca 118 AA PAT REGION 1..118 note Synthetic source 1..118 mol_type protein organism synthetic construct QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYISSSGSTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARDSSQLGFDYWGQGTLVTVSS 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct ggattcaccttcagtgactactac 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct GFTFSDYY 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct attagtagtagtggtagtaccata 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct ISSSGSTI 33 DNA PAT misc_feature 1..33 note Synthetic source 1..33 mol_type other DNA organism synthetic construct gcgagagattcttcccaactgggttttgactac 11 AA PAT REGION 1..11 note Synthetic source 1..11 mol_type protein organism synthetic construct ARDSSQLGFDY 324 DNA PAT misc_feature 1..324 note Synthetic source 1..324 mol_type other DNA organism synthetic construct gacatccagatgacccagtctccatcctccctgtctgcatctgtaggagacagagtcaccatcacttgccgggcaagtcagagcattatcagctttttaaattggtatcagcagaaaccagggaaggcccctaagctcctgatctatactgcatccagtttgcaaagtggggtcccatcaaggttcagtggcagtggatctgggacagatttcactctcaccatcagcagtctacaacctgaagattttgcaacttactactgtcaacagacttacagtaatccgctcactttcggcggagggaccaaggtggaaatcaaacga 108 AA PAT REGION 1..108 note Synthetic source 1..108 mol_type protein organism synthetic construct DIQMTQSPSSLSASVGDRVTITCRASQSIISFLNWYQQKPGKAPKLLIYTASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQTYSNPLTFGGGTKVEIKR 18 DNA PAT misc_feature 1..18 note Synthetic source 1..18 mol_type other DNA organism synthetic construct cagagcattatcagcttt 6 AA PAT REGION 1..6 note Synthetic source 1..6 mol_type protein organism synthetic construct QSIISF 000 000 27 DNA PAT misc_feature 1..27 note Synthetic source 1..27 mol_type other DNA organism synthetic construct caacagacttacagtaatccgctcact 9 AA PAT REGION 1..9 note Synthetic source 1..9 mol_type protein organism synthetic construct QQTYSNPLT 342 DNA PAT misc_feature 1..342 note Synthetic source 1..342 mol_type other DNA organism synthetic construct caggtgcagctggtacagtctggacctgaggtgaagaagcctggggcctcagtgagggtctcctgtaaggcttctggttaccttagtgactttattatcacctgggtgcgacaggcccctggacaagggcttgagtggatgggatggatcagcacttacagtggtgacacagactctgcaccgaagttccagggcagagtcaccatgaccacagacacatccacgactacagtcttcttggaactgaggagcctgagatctgacgacacggccgtgtattattgtgcgagagggcggctgtttgactactggggccagggaaccctggtcaccgtctcctca 114 AA PAT REGION 1..114 note Synthetic source 1..114 mol_type protein organism synthetic construct QVQLVQSGPEVKKPGASVRVSCKASGYLSDFIITWVRQAPGQGLEWMGWISTYSGDTDSAPKFQGRVTMTTDTSTTTVFLELRSLRSDDTAVYYCARGRLFDYWGQGTLVTVSS 21 DNA PAT misc_feature 1..21 note Synthetic source 1..21 mol_type other DNA organism synthetic construct ggttaccttagtgactttatt 7 AA PAT REGION 1..7 note Synthetic source 1..7 mol_type protein organism synthetic construct GYLSDFI 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct atcagcacttacagtggtgacaca 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct ISTYSGDT 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct gcgagagggcggctgtttgactac 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct ARGRLFDY 339 DNA PAT misc_feature 1..339 note Synthetic source 1..339 mol_type other DNA organism synthetic construct gatgttgtgatgactcagtctccactctccctgcccgtcacccttggacagccggcctccatctcctgcaggtctagtcaaagcctcgtatacagtgatggaaacacctacttgaattggtttcaacagaggccaggccaatctccaaggcgcctaatttataaggtttctaaccgggactctggggtcccagacagattcagcggcagtgggtcaggcactgatttcacactgaaaatcagcagggtggaggctgaggatgttggggtttattactgcatgcaaggtacacactggccgtacacttttggccaggggaccaagctggagatcaaacga 113 AA PAT REGION 1..113 note Synthetic source 1..113 mol_type protein organism synthetic construct DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPYTFGQGTKLEIKR 33 DNA PAT misc_feature 1..33 note Synthetic source 1..33 mol_type other DNA organism synthetic construct caaagcctcgtatacagtgatggaaacacctac 11 AA PAT REGION 1..11 note Synthetic source 1..11 mol_type protein organism synthetic construct QSLVYSDGNTY 000 000 27 DNA PAT misc_feature 1..27 note Synthetic source 1..27 mol_type other DNA organism synthetic construct atgcaaggtacacactggccgtacact 9 AA PAT REGION 1..9 note Synthetic source 1..9 mol_type protein organism synthetic construct MQGTHWPYT 354 DNA PAT misc_feature 1..354 note Synthetic source 1..354 mol_type other DNA organism synthetic construct caggtgcagctggtggagtctgggggagtctcggtcaagcctggagggtccctgcgactctcctgtgcagcctctggattcaccttcagtgactactacatgagctggatccgccaggcgccagggaagggactggagtgggtttcgtacattggtagtagtggtactaatgactactacgcagactctgtgaagggccgattcaccatctccagggacaacgccaagaactcactgtatcttcaaatggacagcctgagagccgaggacacggccgtctattactgtgcgagagattcttcccaaatgggttttgactactggggccagggaaccctggtcactgtctcctca 118 AA PAT REGION 1..118 note Synthetic source 1..118 mol_type protein organism synthetic construct QVQLVESGGVSVKPGGSLRLSCAASGFTFSDYYMSWIRQAPGKGLEWVSYIGSSGTNDYYADSVKGRFTISRDNAKNSLYLQMDSLRAEDTAVYYCARDSSQMGFDYWGQGTLVTVSS 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct ggattcaccttcagtgactactac 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct GFTFSDYY 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct attggtagtagtggtactaatgac 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct IGSSGTND 33 DNA PAT misc_feature 1..33 note Synthetic source 1..33 mol_type other DNA organism synthetic construct gcgagagattcttcccaaatgggttttgactac 11 AA PAT REGION 1..11 note Synthetic source 1..11 mol_type protein organism synthetic construct ARDSSQMGFDY 324 DNA PAT misc_feature 1..324 note Synthetic source 1..324 mol_type other DNA organism synthetic construct gacatccagatgacccagtctccatcctccctgtctgcttctgtgggagacagagtcaccatcacttgccgggcaagtcagaacattatcaactttttaaattggtatcagcagagaccagggaaagcccctcagctcctgatctatgttgcagccagcttgcagagtggggtcccatcaaggttcactggcagtggatatgggacagatttcactctcaccatcagcagtctgcaacctgaggatttcgcaacttactactgtcaacagacttacactaacccgctcactttcggcggagggaccaaggtggagatcaaacga 108 AA PAT REGION 1..108 note Synthetic source 1..108 mol_type protein organism synthetic construct DIQMTQSPSSLSASVGDRVTITCRASQNIINFLNWYQQRPGKAPQLLIYVAASLQSGVPSRFTGSGYGTDFTLTISSLQPEDFATYYCQQTYTNPLTFGGGTKVEIKR 18 DNA PAT misc_feature 1..18 note Synthetic source 1..18 mol_type other DNA organism synthetic construct cagaacattatcaacttt 6 AA PAT REGION 1..6 note Synthetic source 1..6 mol_type protein organism synthetic construct QNIINF 000 000 27 DNA PAT misc_feature 1..27 note Synthetic source 1..27 mol_type other DNA organism synthetic construct caacagacttacactaacccgctcact 9 AA PAT REGION 1..9 note Synthetic source 1..9 mol_type protein organism synthetic construct QQTYTNPLT 460 AA PAT source 1..460 mol_type protein organism Homo sapiens MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE 26 AA PAT REGION 1..26 note Synthetic source 1..26 mol_type protein organism synthetic construct EPKSRFAMLDDVKILANGLLQLGHGL 363 DNA PAT misc_feature 1..363 note Synthetic source 1..363 mol_type other DNA organism synthetic construct gaggtgcagcttttggagtctgggggaggcttggtacagcctggggggtccctgagactctcctgtgcagcctctggattcacctttagcacctatgccatgagctgggtccgccaggctccagggaaggggctggagggggtctcaggtattagtggtactggttatagaacatactacgcagactccgtgaagggccgattcaccatctccagagacaattccaagaactcgctgtatctgcaaatgaacagcctgagagccgaggacacggccgtatattactgtgcgaaagatcggggcttactatggttcggggaattaacctactggggccagggaaccctggtcaccgtctcctca 121 AA PAT REGION 1..121 note Synthetic source 1..121 mol_type protein organism synthetic construct EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEGVSGISGTGYRTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTAVYYCAKDRGLLWFGELTYWGQGTLVTVSS 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct ggattcacctttagcacctatgcc 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct GFTFSTYA 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct attagtggtactggttatagaaca 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct ISGTGYRT 42 DNA PAT misc_feature 1..42 note Synthetic source 1..42 mol_type other DNA organism synthetic construct gcgaaagatcggggcttactatggttcggggaattaacctac 14 AA PAT REGION 1..14 note Synthetic source 1..14 mol_type protein organism synthetic construct AKDRGLLWFGELTY 318 DNA PAT misc_feature 1..318 note Synthetic source 1..318 mol_type other DNA organism synthetic construct gacatccagatgacccagtctccttccaccctgtctgcatctgtaggagacagagtcaccatcacttgccgggccagtcagagtattaataactggttggcctggtatcaacagaaaccagggaaggcccctaacctcctgatctataaggcgtctagtttagaaagtggggtcccatcaaggttcagcggcagtggatctgggacagaattcactctcaccatcagcagcctgcagcctgatgattttgcaacttattactgccaacaatataatgattattggacgttcggccaagggaccaaggtggaaatcaaa 106 AA PAT REGION 1..106 note Synthetic source 1..106 mol_type protein organism synthetic construct DIQMTQSPSTLSASVGDRVTITCRASQSINNWLAWYQQKPGKAPNLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNDYWTFGQGTKVEIK 18 DNA PAT misc_feature 1..18 note Synthetic source 1..18 mol_type other DNA organism synthetic construct cagagtattaataactgg 6 AA PAT REGION 1..6 note Synthetic source 1..6 mol_type protein organism synthetic construct QSINNW 000 000 24 DNA PAT misc_feature 1..24 note Synthetic source 1..24 mol_type other DNA organism synthetic construct caacaatataatgattattggacg 8 AA PAT REGION 1..8 note Synthetic source 1..8 mol_type protein organism synthetic construct QQYNDYWT 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct acgtggaactgttttcttct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aacgtggaactgttttcttc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caacgtggaactgttttctt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gcaacgtggaactgttttct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aagcaacgtggaactgtttt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caagcaacgtggaactgttt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcaagcaacgtggaactgtt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tttcaagcaacgtggaactg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atttcaagcaacgtggaact 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aatttcaagcaacgtggaac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caatttcaagcaacgtggaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcaatttcaagcaacgtgga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctggaggaaataactagag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gattttggctctggagatag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgattttggctctggagata 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttgattttggctctggagat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aaggaggccattggctaaaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gaaggaggccattggctaaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctgaaggaggccattggcta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aactgaaggaggccattggc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtcccaactgaaggaggcca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atgtcccaactgaaggaggc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gaccatgtcccaactgaagg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agaccatgtcccaactgaag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aagaccatgtcccaactgaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct taagaccatgtcccaactga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttaagaccatgtcccaactg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tttaagaccatgtcccaact 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctttaagaccatgtcccaac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctttaagaccatgtcccaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cgtcttatggacaaagtctt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcgtcttatggacaaagtct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttcgtcttatggacaaagtc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cttcgtcttatggacaaagt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccttcgtcttatggacaaag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cccttcgtcttatggacaaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gcccttcgtcttatggacaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggcccttcgtcttatggaca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tggcccttcgtcttatggac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttggcccttcgtcttatgga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tttggcccttcgtcttatgg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atttggcccttcgtcttatg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aatttggcccttcgtcttat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct taatttggcccttcgtctta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttaatttggcccttcgtctt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtttgcagcgatagatcata 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggtttgcagcgatagatcat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tggtttgcagcgatagatca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctggtttgcagcgatagatc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct actggtttgcagcgatagat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cactggtttgcagcgataga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcactggtttgcagcgatag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttcactggtttgcagcgata 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atttcactggtttgcagcga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gatttcactggtttgcagcg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttgatttcactggtttgcag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctcagttccttttcttcttc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gagttgagttcaagtgacat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgagttgagttcaagtgaca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctggagtttcaggttgattt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctggagtttcaggttgatt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gttctggagtttcaggttga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggtgttctggagtttcaggt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gggtgttctggagtttcagg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aagttacttctgggtgttct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggagaaggtctttgatgcta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tggagaaggtctttgatgct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctggagaaggtctttgatgc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggtctggagaaggtctttga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cggtctggagaaggtctttg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct acggtctggagaaggtcttt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccacggtctggagaaggtct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct attggtcttccacggtctgg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tattggtcttccacggtctg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atattggtcttccacggtct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttatattggtcttccacggt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tttatattggtcttccacgg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtttatattggtcttccacg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtccttctgagctgattttc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agtccttctgagctgatttt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctagtccttctgagctgatt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgtgggttcttgaatactag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctgtgggttcttgaatacta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttctgtgggttcttgaatac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tggcttggaagatagagaaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cttggcttggaagatagaga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agttcttggtgctcttggct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tagttcttggtgctcttggc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtagttcttggtgctcttgg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gagtagttcttggtgctctt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggagtagttcttggtgctct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gggagtagttcttggtgctc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agggagtagttcttggtgct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aaagggagtagttcttggtg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gaaagggagtagttcttggt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caactgaagaaagggagtag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcaactgaagaaagggagta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttcaactgaagaaagggagt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agcaggaatgccatcatgtt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cagcaggaatgccatcatgt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcagcaggaatgccatcatg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttcagcaggaatgccatcat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggtggtacattcagcaggaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tggtggtacattcagcagga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cttgtatgttcacctctgtt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccacttgtatgttcacctct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gccacttgtatgttcacctc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgccacttgtatgttcacct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gttgctgggtctgatggcat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gagttgctgggtctgatggc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gagagttgctgggtctgatg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct acttgagagttgctgggtct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggactacctgatataacatc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct catggactacctgatataac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cccacgtttcattgaagttt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcccacgtttcattgaagtt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctcccacgtttcattgaagt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctcccacgtttcattgaag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttctcccacgtttcattgaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gttctcccacgtttcattga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agttctcccacgtttcattg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tagttctcccacgtttcatt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtagttctcccacgtttcat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgtagttctcccacgtttca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttgtagttctcccacgtttc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tttgtagttctcccacgttt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atttgtagttctcccacgtt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tatttgtagttctcccacgt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atatttgtagttctcccacg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct accatatttgtagttctccc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agcctcccaaaaccatattt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aagcctcccaaaaccatatt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caagcctcccaaaaccatat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcaagcctcccaaaaccata 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atcaagcctcccaaaaccat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct catcaagcctcccaaaacca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccatcaagcctcccaaaacc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctccatcaagcctcccaaaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctccatcaagcctcccaaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aattctccatcaagcctccc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aaattctccatcaagcctcc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aaaattctccatcaagcctc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccaaaattctccatcaagcc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct accaaaattctccatcaagc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccaaccaaaattctccatca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cccaaccaaaattctccatc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gcccaaccaaaattctccat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggcccaaccaaaattctcca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aggcccaaccaaaattctcc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct taggcccaaccaaaattctc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctaggcccaaccaaaattc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctctaggcccaaccaaaatt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctctaggcccaaccaaaat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttctctaggcccaaccaaaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cttctctaggcccaaccaaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcttctctaggcccaaccaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tatcttctctaggcccaacc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atatcttctctaggcccaac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tatatcttctctaggcccaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtatatcttctctaggccca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agtatatcttctctaggccc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gagtatatcttctctaggcc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggagtatatcttctctaggc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tggagtatatcttctctagg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gcttcactatggagtatatc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agattgcttcactatggagt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tagattgcttcactatggag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gttgtctttccagtcttcca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgtttgttgtctttccagtc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtttcgtgatttcccaagta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggtttcgtgatttcccaagt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gttggtttcgtgatttccca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agttggtttcgtgatttccc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tagttggtttcgtgatttcc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cgtatagttggtttcgtgat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gcgtatagttggtttcgtga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agcgtatagttggtttcgtg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tagcgtatagttggtttcgt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtagcgtatagttggtttcg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgtagcgtatagttggtttc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agatgtagcgtatagttggt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctagatgtagcgtatagttg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caactagatgtagcgtatag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gcaactagatgtagcgtata 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cgcaactagatgtagcgtat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcgcaactagatgtagcgta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atcgcaactagatgtagcgt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aatcgcaactagatgtagcg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct taatcgcaactagatgtagc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtaatcgcaactagatgtag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cagtaatcgcaactagatgt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggacattgccagtaatcgca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gggacattgccagtaatcgc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttttccgggattgcattggg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gttttccgggattgcattgg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgttttccgggattgcattg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttgttttccgggattgcatt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tttgttttccgggattgcat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctttgttttccgggattgca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctttgttttccgggattgc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atctttgttttccgggattg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caaatctttgttttccggga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caccaaatctttgttttccg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cccaagtagaaaacaccaaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcccaagtagaaaacaccaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctttgtgatcccaagtagaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgctttgtgatcccaagtag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tttgctttgtgatcccaagt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cttttgctttgtgatcccaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccttttgctttgtgatccca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtccttttgctttgtgatcc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgtccttttgctttgtgatc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gttgaagtgtccttttgctt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agttgaagtgtccttttgct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cagttgaagtgtccttttgc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cctctggacagttgaagtgt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aaccctctggacagttgaag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct taaccctctggacagttgaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ataaccctctggacagttga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aataaccctctggacagttg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gaataaccctctggacagtt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgaataaccctctggacagt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctcctgaataaccctctgga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cctcctgaataaccctctgg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agcctcctgaataaccctct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cagcctcctgaataaccctc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccagcctcctgaataaccct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct accagcctcctgaataaccc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccaccagcctcctgaataac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct accaccagcctcctgaataa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caccaccagcctcctgaata 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct actcatcatgccaccaccag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cactcatcatgccaccacca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cacactcatcatgccaccac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tccacactcatcatgccacc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctccacactcatcatgcca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttaggttgttttctccacac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gcttagattttgctcttggt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggcttagattttgctcttgg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cctctctggcttagattttg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcctctctggcttagatttt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctcctctctggcttagattt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gacttccaagataatcctct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agacttccaagataatcctc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gagacttccaagataatcct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgagacttccaagataatcc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gaatctgttggatggatcaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgaatctgttggatggatca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gcctcagttcattcaaagct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgcctcagttcattcaaagc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gggaaagttgtgatattagc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cagtcctctgtatttagtca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccagtcctctgtatttagtc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct taccagtcctctgtatttag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caattaccagtcctctgtat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct acaattaccagtcctctgta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtacaattaccagtcctctg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tactctgtgctgacgatttt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atactctgtgctgacgattt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct catactctgtgctgacgatt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gaatcacagcatatttaggg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cttgaaaacctacacgaatg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctacttgaaaacctacacga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctacttgaaaacctacacg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atacatgcttgtcaggctgt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atatacatgcttgtcaggct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gactgggtctttgtttattg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agggactgggtctttgttta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tagggactgggtctttgttt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttagggactgggtctttgtt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atttagggactgggtctttg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct taatttagggactgggtctt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctataatttagggactgggt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctataatttagggactggg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctgttgtgatgtcgataaac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggatctgttgtgatgtcgat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gggatctgttgtgatgtcga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agggatctgttgtgatgtcg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgacaagtgatactgtggta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ctgacaagtgatactgtggt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tctgacaagtgatactgtgg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttctgacaagtgatactgtg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gggcactatatcctttaaca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tgggcactatatcctttaac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cttgggcactatatccttta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct acttgggcactatatccttt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aacttgggcactatatcctt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct taacttgggcactatatcct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ataacttgggcactatatcc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccatataacttgggcactat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct accatataacttgggcacta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caccatataacttgggcact 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcaccatataacttgggcac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aggtcaccatataacttggg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct taggtcaccatataacttgg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gtaggtcaccatataacttg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggtaggtcaccatataactt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aggtaggtcaccatataact 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aaggtaggtcaccatataac 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caaaggtaggtcaccatata 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct acaaaggtaggtcaccatat 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gacaaaggtaggtcaccata 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gcttagtctgtggtcctgaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agcttagtctgtggtcctga 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cagcttagtctgtggtcctg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aatttcgacagcttagtctg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cgttaatttcgacagcttag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gcgttaatttcgacagctta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agcgttaatttcgacagctt 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cagcgttaatttcgacagct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tcagcgttaatttcgacagc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct atcagcgttaatttcgacag 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttggtattctggccctaaaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct tttggtattctggccctaaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ttttggtattctggccctaa 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct attttggtattctggcccta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct cattttggtattctggccct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ccattttggtattctggccc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gagccattttggtattctgg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct ggagccattttggtattctg 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aggagccattttggtattct 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct gaggagccattttggtattc 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct agagaggagccattttggta 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct caaatagaggaagcaactca 20 RNA PAT misc_feature 1..20 note antisense sequence source 1..20 mol_type other RNA organism synthetic construct aaccaaatagaggaagcaac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cagttccacgttgcttgaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttcaagcaacgtggaactg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttgttcctctagttatttc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gaaataactagaggaacaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgttcctctagttatttcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggaaataactagaggaaca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctagttatttcctccagaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttctggaggaaataactag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tagttatttcctccagaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attctggaggaaataacta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agttatttcctccagaatt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aattctggaggaaataact 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gttatttcctccagaattg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct caattctggaggaaataac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttatttcctccagaattga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcaattctggaggaaataa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atttcctccagaattgatc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gatcaattctggaggaaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttcctccagaattgatcaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttgatcaattctggaggaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcctccagaattgatcaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttgatcaattctggagga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cctccagaattgatcaaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcttgatcaattctggagg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct catcatttgattctctatc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gatagagaatcaaatgatg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcatttgattctctatctc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gagatagagaatcaaatga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct catttgattctctatctcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggagatagagaatcaaatg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atttgattctctatctcca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tggagatagagaatcaaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tttgattctctatctccag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctggagatagagaatcaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttgattctctatctccaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tctggagatagagaatcaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctatctccagagccaaaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attttggctctggagatag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tatctccagagccaaaatc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gattttggctctggagata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atctccagagccaaaatca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgattttggctctggagat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tccagagccaaaatcaaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcttgattttggctctgga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccagagccaaaatcaagat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atcttgattttggctctgg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cagagccaaaatcaagatt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aatcttgattttggctctg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caagatttgctatgttaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tctaacatagcaaatcttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aagatttgctatgttagac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtctaacatagcaaatctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agatttgctatgttagacg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cgtctaacatagcaaatct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gatttgctatgttagacga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcgtctaacatagcaaatc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atttgctatgttagacgat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atcgtctaacatagcaaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tttgctatgttagacgatg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct catcgtctaacatagcaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttgctatgttagacgatgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acatcgtctaacatagcaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgctatgttagacgatgta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tacatcgtctaacatagca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gctatgttagacgatgtaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttacatcgtctaacatagc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctatgttagacgatgtaaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tttacatcgtctaacatag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaaattttagccaatggcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggccattggctaaaatttt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaattttagccaatggcct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aggccattggctaaaattt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct attttagccaatggcctcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggaggccattggctaaaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tagccaatggcctccttca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgaaggaggccattggcta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agccaatggcctccttcag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctgaaggaggccattggct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gccaatggcctccttcagt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct actgaaggaggccattggc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caatggcctccttcagttg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct caactgaaggaggccattg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aatggcctccttcagttgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccaactgaaggaggccatt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tggcctccttcagttggga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcccaactgaaggaggcca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggcctccttcagttgggac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtcccaactgaaggaggcc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gcctccttcagttgggaca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgtcccaactgaaggaggc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cctccttcagttgggacat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atgtcccaactgaaggagg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctccttcagttgggacatg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct catgtcccaactgaaggag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cttcagttgggacatggtc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gaccatgtcccaactgaag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttcagttgggacatggtct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agaccatgtcccaactgaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcagttgggacatggtctt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aagaccatgtcccaactga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttgggacatggtcttaaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctttaagaccatgtcccaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgggacatggtcttaaaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tctttaagaccatgtccca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcttaaagactttgtccat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atggacaaagtctttaaga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cttaaagactttgtccata 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tatggacaaagtctttaag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct taaagactttgtccataag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttatggacaaagtcttta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaagactttgtccataaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcttatggacaaagtcttt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct actttgtccataagacgaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttcgtcttatggacaaagt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctttgtccataagacgaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttcgtcttatggacaaag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tttgtccataagacgaagg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccttcgtcttatggacaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttgtccataagacgaaggg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cccttcgtcttatggacaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgtccataagacgaagggc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gcccttcgtcttatggaca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtccataagacgaagggcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggcccttcgtcttatggac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ataagacgaagggccaaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atttggcccttcgtcttat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct taagacgaagggccaaatt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aatttggcccttcgtctta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aagacgaagggccaaatta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taatttggcccttcgtctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agacgaagggccaaattaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttaatttggcccttcgtct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gacgaagggccaaattaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attaatttggcccttcgtc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct acgaagggccaaattaatg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cattaatttggcccttcgt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cgaagggccaaattaatga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcattaatttggcccttcg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaagggccaaattaatgac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtcattaatttggcccttc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gggccaaattaatgacata 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tatgtcattaatttggccc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggccaaattaatgacatat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atatgtcattaatttggcc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttttatgatctatcgctgc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gcagcgatagatcataaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttatgatctatcgctgcaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttgcagcgatagatcataa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tatgatctatcgctgcaaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tttgcagcgatagatcata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaagaggtaaagaatatgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acatattctttacctcttc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aagaggtaaagaatatgtc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gacatattctttacctctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaagagcaactaactaact 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agttagttagttgctcttc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aagagcaactaactaactt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aagttagttagttgctctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agagcaactaactaactta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taagttagttagttgctct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gagcaactaactaacttaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttaagttagttagttgctc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caagataatagcatcaaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctttgatgctattatcttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agataatagcatcaaagac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtctttgatgctattatct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gataatagcatcaaagacc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggtctttgatgctattatc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ataatagcatcaaagacct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aggtctttgatgctattat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct taatagcatcaaagacctt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aaggtctttgatgctatta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agcatcaaagaccttctcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggagaaggtctttgatgct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gcatcaaagaccttctcca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tggagaaggtctttgatgc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct catcaaagaccttctccag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctggagaaggtctttgatg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atcaaagaccttctccaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tctggagaaggtctttgat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcaaagaccttctccagac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtctggagaaggtctttga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caaagaccttctccagacc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggtctggagaaggtctttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaagaccttctccagaccg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cggtctggagaaggtcttt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aagaccttctccagaccgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acggtctggagaaggtctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agaccttctccagaccgtg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cacggtctggagaaggtct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaccttctccagaccgtgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccacggtctggagaaggtc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaccgtggaagaccaatat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atattggtcttccacggtc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccgtggaagaccaatataa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttatattggtcttccacgg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cgtggaagaccaatataaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tttatattggtcttccacg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cagcatagtcaaataaaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttttatttgactatgctg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaatcagctcagaaggact 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agtccttctgagctgattt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aatcagctcagaaggacta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tagtccttctgagctgatt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atcagctcagaaggactag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctagtccttctgagctgat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcagctcagaaggactagt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct actagtccttctgagctga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agctcagaaggactagtat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atactagtccttctgagct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cagaaggactagtattcaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttgaatactagtccttctg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agaaggactagtattcaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttgaatactagtccttct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaaggactagtattcaaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcttgaatactagtccttc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaggactagtattcaagaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttcttgaatactagtcctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aatttctctatcttccaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttggaagatagagaaatt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atttctctatcttccaagc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gcttggaagatagagaaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tttctctatcttccaagcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggcttggaagatagagaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttctctatcttccaagcca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tggcttggaagatagagaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tctctatcttccaagccaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttggcttggaagatagaga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctctatcttccaagccaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttggcttggaagatagag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccaagccaagagcaccaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttggtgctcttggcttgg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caagccaagagcaccaaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcttggtgctcttggcttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aagccaagagcaccaagaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttcttggtgctcttggctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctactccctttcttcagtt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aactgaagaaagggagtag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tactccctttcttcagttg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct caactgaagaaagggagta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct actccctttcttcagttga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcaactgaagaaagggagt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctccctttcttcagttgaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttcaactgaagaaagggag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tccctttcttcagttgaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attcaactgaagaaaggga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccctttcttcagttgaatg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cattcaactgaagaaaggg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtatgccatcagacccagc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gctgggtctgatggcatac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tatgccatcagacccagca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgctgggtctgatggcata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgccatcagacccagcaac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gttgctgggtctgatggca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gccatcagacccagcaact 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agttgctgggtctgatggc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcagacccagcaactctca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgagagttgctgggtctga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cagacccagcaactctcaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttgagagttgctgggtctg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gacccagcaactctcaagt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acttgagagttgctgggtc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttcatgtctactgtgatgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acatcacagtagacatgaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcatgtctactgtgatgtt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aacatcacagtagacatga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct catgtctactgtgatgtta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taacatcacagtagacatg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atgtctactgtgatgttat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ataacatcacagtagacat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgtctactgtgatgttata 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tataacatcacagtagaca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gatgttatatcaggtagtc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gactacctgatataacatc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atgttatatcaggtagtcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggactacctgatataacat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgttatatcaggtagtcca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tggactacctgatataaca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gttatatcaggtagtccat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atggactacctgatataac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tatcaggtagtccatggac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtccatggactacctgata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atcaggtagtccatggaca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgtccatggactacctgat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcaggtagtccatggacat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atgtccatggactacctga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caggtagtccatggacatt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aatgtccatggactacctg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aggtagtccatggacatta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taatgtccatggactacct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggtagtccatggacattaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttaatgtccatggactacc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtagtccatggacattaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attaatgtccatggactac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tagtccatggacattaatt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aattaatgtccatggacta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agtccatggacattaattc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gaattaatgtccatggact 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtccatggacattaattca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgaattaatgtccatggac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tccatggacattaattcaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttgaattaatgtccatgga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccatggacattaattcaac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gttgaattaatgtccatgg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atcgaatagatggatcaca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgtgatccatctattcgat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aatatggttttgggaggct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agcctcccaaaaccatatt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atatggttttgggaggctt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aagcctcccaaaaccatat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tatggttttgggaggcttg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct caagcctcccaaaaccata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atggttttgggaggcttga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcaagcctcccaaaaccat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tggttttgggaggcttgat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atcaagcctcccaaaacca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggttttgggaggcttgatg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct catcaagcctcccaaaacc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gttttgggaggcttgatgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccatcaagcctcccaaaac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttttgggaggcttgatgga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tccatcaagcctcccaaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agaattttggttgggccta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taggcccaaccaaaattct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaattttggttgggcctag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctaggcccaaccaaaattc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aattttggttgggcctaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tctaggcccaaccaaaatt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct attttggttgggcctagag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctctaggcccaaccaaaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agaagatatactccatagt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct actatggagtatatcttct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaagatatactccatagtg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cactatggagtatatcttc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aagatatactccatagtga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcactatggagtatatctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gatatactccatagtgaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttcactatggagtatatc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atatactccatagtgaagc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gcttcactatggagtatat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tatactccatagtgaagca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgcttcactatggagtata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atactccatagtgaagcaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttgcttcactatggagtat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tactccatagtgaagcaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attgcttcactatggagta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct actccatagtgaagcaatc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gattgcttcactatggagt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctccatagtgaagcaatct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agattgcttcactatggag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tccatagtgaagcaatcta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tagattgcttcactatgga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccatagtgaagcaatctaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttagattgcttcactatgg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct catagtgaagcaatctaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attagattgcttcactatg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtgaagcaatctaattatg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cataattagattgcttcac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caactatacgctacatcta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tagatgtagcgtatagttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aactatacgctacatctag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctagatgtagcgtatagtt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tacgctacatctagttgcg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cgcaactagatgtagcgta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct acgctacatctagttgcga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcgcaactagatgtagcgt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cgctacatctagttgcgat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atcgcaactagatgtagcg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gctacatctagttgcgatt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aatcgcaactagatgtagc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctacatctagttgcgatta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taatcgcaactagatgtag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tacatctagttgcgattac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtaatcgcaactagatgta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct acatctagttgcgattact 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agtaatcgcaactagatgt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgcgattactggcaatgtc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gacattgccagtaatcgca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gcgattactggcaatgtcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggacattgccagtaatcgc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cgattactggcaatgtccc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gggacattgccagtaatcg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caaagatttggtgttttct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agaaaacaccaaatctttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tttggtgttttctacttgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccaagtagaaaacaccaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttggtgttttctacttggg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cccaagtagaaaacaccaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gttttctacttgggatcac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtgatcccaagtagaaaac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttttctacttgggatcaca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgtgatcccaagtagaaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aagcaaaaggacacttcaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttgaagtgtccttttgctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agcaaaaggacacttcaac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gttgaagtgtccttttgct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gcaaaaggacacttcaact 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agttgaagtgtccttttgc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caaaaggacacttcaactg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cagttgaagtgtccttttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaaaggacacttcaactgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acagttgaagtgtcctttt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cttcaactgtccagagggt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct accctctggacagttgaag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttcaactgtccagagggtt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aaccctctggacagttgaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcaactgtccagagggtta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taaccctctggacagttga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caactgtccagagggttat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ataaccctctggacagttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aactgtccagagggttatt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aataaccctctggacagtt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct actgtccagagggttattc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gaataaccctctggacagt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctgtccagagggttattca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgaataaccctctggacag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgtccagagggttattcag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctgaataaccctctggaca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtccagagggttattcagg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cctgaataaccctctggac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agagggttattcaggaggc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gcctcctgaataaccctct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gagggttattcaggaggct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agcctcctgaataaccctc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agggttattcaggaggctg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cagcctcctgaataaccct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gggttattcaggaggctgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccagcctcctgaataaccc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggttattcaggaggctggt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct accagcctcctgaataacc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gttattcaggaggctggtg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct caccagcctcctgaataac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttattcaggaggctggtgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccaccagcctcctgaataa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tattcaggaggctggtggt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct accaccagcctcctgaata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct attcaggaggctggtggtg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct caccaccagcctcctgaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttcaggaggctggtggtgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccaccaccagcctcctgaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaggctggtggtggcatga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcatgccaccaccagcctc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aggctggtggtggcatgat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atcatgccaccaccagcct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctggtggtggcatgatgag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctcatcatgccaccaccag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tggtggtggcatgatgagt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct actcatcatgccaccacca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggtggtggcatgatgagtg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cactcatcatgccaccacc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtggtggcatgatgagtgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acactcatcatgccaccac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tggtggcatgatgagtgtg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cacactcatcatgccacca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggtggcatgatgagtgtgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccacactcatcatgccacc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtggcatgatgagtgtgga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tccacactcatcatgccac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tggcatgatgagtgtggag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctccacactcatcatgcca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct accaagagcaaaatctaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttagattttgctcttggt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccaagagcaaaatctaagc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gcttagattttgctcttgg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caagagcaaaatctaagcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggcttagattttgctcttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agaggattatcttggaagt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acttccaagataatcctct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaggattatcttggaagtc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gacttccaagataatcctc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aggattatcttggaagtct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agacttccaagataatcct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggattatcttggaagtctc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gagacttccaagataatcc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gattatcttggaagtctca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgagacttccaagataatc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct attatcttggaagtctcaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttgagacttccaagataat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttatcttggaagtctcaaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tttgagacttccaagataa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tatcttggaagtctcaaaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttttgagacttccaagata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atcttggaagtctcaaaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attttgagacttccaagat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcttggaagtctcaaaatg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cattttgagacttccaaga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cttggaagtctcaaaatgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccattttgagacttccaag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttggaagtctcaaaatgga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tccattttgagacttccaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tggaagtctcaaaatggaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttccattttgagacttcca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggaagtctcaaaatggaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttccattttgagacttcc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aagtctcaaaatggaaggt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct accttccattttgagactt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agtctcaaaatggaaggtt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aaccttccattttgagact 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtctcaaaatggaaggtta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taaccttccattttgagac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tctcaaaatggaaggttat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ataaccttccattttgaga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctcaaaatggaaggttata 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tataaccttccattttgag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcaaaatggaaggttatac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtataaccttccattttga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caaaatggaaggttatact 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agtataaccttccattttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atggaaggttatactctat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atagagtataaccttccat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaccaaaatgttgatccat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atggatcaacattttggtt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccaaaatgttgatccatcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggatggatcaacattttgg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caaaatgttgatccatcca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tggatggatcaacattttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct actgaggcaaatttaaaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttttaaatttgcctcagt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctgaggcaaatttaaaagg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccttttaaatttgcctcag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaggcaaatttaaaaggca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgccttttaaatttgcctc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aggcaaatttaaaaggcaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttgccttttaaatttgcct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct acattaacctcattccaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttggaatgaggttaatgt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cattaacctcattccaagt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acttggaatgaggttaatg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct attaacctcattccaagtt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aacttggaatgaggttaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aacctcattccaagttaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attaacttggaatgaggtt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tccaagttaatgtggtcta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tagaccacattaacttgga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccaagttaatgtggtctaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttagaccacattaacttgg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caagttaatgtggtctaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attagaccacattaacttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aatgtggtctaataatctg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cagattattagaccacatt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tggtctaataatctggtat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ataccagattattagacca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttatcttaaagtcactgtc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gacagtgactttaagataa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tatcttaaagtcactgtct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agacagtgactttaagata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atcttaaagtcactgtcta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tagacagtgactttaagat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcttaaagtcactgtctat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atagacagtgactttaaga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cttaaagtcactgtctatt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aatagacagtgactttaag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aagtcactgtctatttaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttaaatagacagtgactt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agtcactgtctatttaaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcttaaatagacagtgact 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caatcacataaccttaaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctttaaggttatgtgattg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ataaccttaaagaataccg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cggtattctttaaggttat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct taaccttaaagaataccgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acggtattctttaaggtta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaccttaaagaataccgtt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aacggtattctttaaggtt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct accttaaagaataccgttt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aaacggtattctttaaggt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agaataccgtttacatttc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gaaatgtaaacggtattct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaataccgtttacatttct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agaaatgtaaacggtattc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct accgtttacatttctcaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attgagaaatgtaaacggt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccgtttacatttctcaatc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gattgagaaatgtaaacgg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cgtttacatttctcaatca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgattgagaaatgtaaacg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttaaattttgtgatgtggg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cccacatcacaaaatttaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct attttgtgatgtgggaatc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gattcccacatcacaaaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gatgtgggaatcaatttta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taaaattgattcccacatc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atgtgggaatcaattttag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctaaaattgattcccacat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgtgggaatcaattttaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tctaaaattgattcccaca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtgggaatcaattttagat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atctaaaattgattcccac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgggaatcaattttagatg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct catctaaaattgattccca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gggaatcaattttagatgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccatctaaaattgattccc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggaatcaattttagatggt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct accatctaaaattgattcc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaatcaattttagatggtc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gaccatctaaaattgattc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcaattttagatggtcaca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgtgaccatctaaaattga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttaaaaggcatcatatgag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctcatatgatgccttttaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaggcatcatatgagctaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttagctcatatgatgcctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aggcatcatatgagctaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attagctcatatgatgcct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggcatcatatgagctaata 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tattagctcatatgatgcc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aacttgactaaatacagag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctctgtatttagtcaagtt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct acttgactaaatacagagg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cctctgtatttagtcaagt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cttgactaaatacagagga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcctctgtatttagtcaag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttgactaaatacagaggac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtcctctgtatttagtcaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgactaaatacagaggact 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agtcctctgtatttagtca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct taaatacagaggactggta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taccagtcctctgtattta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaatacagaggactggtaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttaccagtcctctgtattt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aatacagaggactggtaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attaccagtcctctgtatt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tacagaggactggtaattg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct caattaccagtcctctgta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct acagaggactggtaattgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acaattaccagtcctctgt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cagaggactggtaattgta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tacaattaccagtcctctg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agaggactggtaattgtac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtacaattaccagtcctct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctggtaattgtacagttct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agaactgtacaattaccag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tggtaattgtacagttctt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aagaactgtacaattacca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggtaattgtacagttctta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taagaactgtacaattacc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cagttcttaaatgttgtag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctacaacatttaagaactg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaaatcgtcagcacagagt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct actctgtgctgacgatttt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaatcgtcagcacagagta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tactctgtgctgacgattt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aatcgtcagcacagagtat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atactctgtgctgacgatt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atcgtcagcacagagtatg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct catactctgtgctgacgat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aactgatgcttcattttgc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gcaaaatgaagcatcagtt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct actgatgcttcattttgct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agcaaaatgaagcatcagt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctgatgcttcattttgcta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tagcaaaatgaagcatcag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gatgcttcattttgctaca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgtagcaaaatgaagcatc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gaagcagaattaaatactg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cagtatttaattctgcttc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttaaaataagttcgctgtc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gacagcgaacttattttaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct taaaataagttcgctgtct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agacagcgaacttatttta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaaataagttcgctgtctt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aagacagcgaacttatttt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct taagttcgctgtctttaaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tttaaagacagcgaactta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct attgtaaaggaatcttgtc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gacaagattcctttacaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttgtaaaggaatcttgtca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgacaagattcctttacaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgtaaaggaatcttgtcag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctgacaagattcctttaca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtaaaggaatcttgtcaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tctgacaagattcctttac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cttgtcagattacagtaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttactgtaatctgacaag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttgtcagattacagtaaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcttactgtaatctgacaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgtcagattacagtaagaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttcttactgtaatctgaca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtcagattacagtaagaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attcttactgtaatctgac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcagattacagtaagaatg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cattcttactgtaatctga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tatgctgtgattctaatac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtattagaatcacagcata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atgctgtgattctaataca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgtattagaatcacagcat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gctgtgattctaatacatt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aatgtattagaatcacagc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctgtgattctaatacattc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gaatgtattagaatcacag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgtgattctaatacattcg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cgaatgtattagaatcaca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtgattctaatacattcgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acgaatgtattagaatcac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgattctaatacattcgtg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cacgaatgtattagaatca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gattctaatacattcgtgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acacgaatgtattagaatc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct acattcgtgtaggttttca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgaaaacctacacgaatgt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cattcgtgtaggttttcaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttgaaaacctacacgaatg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct attcgtgtaggttttcaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttgaaaacctacacgaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttcgtgtaggttttcaagt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acttgaaaacctacacgaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcgtgtaggttttcaagta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tacttgaaaacctacacga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cgtgtaggttttcaagtag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctacttgaaaacctacacg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtgtaggttttcaagtaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tctacttgaaaacctacac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct caaagacccagtccctaaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tttagggactgggtctttg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaagacccagtccctaaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atttagggactgggtcttt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aagacccagtccctaaatt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aatttagggactgggtctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gacccagtccctaaattat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ataatttagggactgggtc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tattcttgcatgtttatcg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cgataaacatgcaagaata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct attcttgcatgtttatcga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcgataaacatgcaagaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttcttgcatgtttatcgac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtcgataaacatgcaagaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcttgcatgtttatcgaca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgtcgataaacatgcaaga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aatccctaaatccctaaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctttagggatttagggatt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tccctaaatccctaaagat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atctttagggatttaggga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttttaccacagtatcactt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aagtgatactgtggtaaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tttaccacagtatcacttg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct caagtgatactgtggtaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttaccacagtatcacttgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acaagtgatactgtggtaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct taccacagtatcacttgtc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gacaagtgatactgtggta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct accacagtatcacttgtca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgacaagtgatactgtggt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccacagtatcacttgtcag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctgacaagtgatactgtgg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cacagtatcacttgtcaga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tctgacaagtgatactgtg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct acagtatcacttgtcagaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttctgacaagtgatactgt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cagtatcacttgtcagaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attctgacaagtgatactg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agtatcacttgtcagaatt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aattctgacaagtgatact 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttgttaaaggatatagtgc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gcactatatcctttaacaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgttaaaggatatagtgcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggcactatatcctttaaca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gttaaaggatatagtgccc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gggcactatatcctttaac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttaaaggatatagtgccca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgggcactatatcctttaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct taaaggatatagtgcccaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttgggcactatatccttta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaaggatatagtgcccaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttgggcactatatccttt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aaggatatagtgcccaagt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acttgggcactatatcctt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aggatatagtgcccaagtt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aacttgggcactatatcct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggatatagtgcccaagtta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taacttgggcactatatcc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agtgcccaagttatatggt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct accatataacttgggcact 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gtgcccaagttatatggtg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct caccatataacttgggcac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgcccaagttatatggtga 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tcaccatataacttgggca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gcccaagttatatggtgac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtcaccatataacttgggc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cccaagttatatggtgacc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggtcaccatataacttggg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agttatatggtgacctacc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggtaggtcaccatataact 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atatggtgacctacctttg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct caaaggtaggtcaccatat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tatggtgacctacctttgt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acaaaggtaggtcaccata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atggtgacctacctttgtc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gacaaaggtaggtcaccat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gacctacctttgtcaatac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtattgacaaaggtaggtc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct acctacctttgtcaatact 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agtattgacaaaggtaggt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctacctttgtcaatactta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taagtattgacaaaggtag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tacctttgtcaatacttag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ctaagtattgacaaaggta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct acctttgtcaatacttagc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gctaagtattgacaaaggt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cctttgtcaatacttagca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tgctaagtattgacaaagg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctttgtcaatacttagcat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct atgctaagtattgacaaag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgtatgatctatgtgaatc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gattcacatagatcataca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tatgatctatgtgaatcct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aggattcacatagatcata 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atgatctatgtgaatccta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct taggattcacatagatcat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgatctatgtgaatcctaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttaggattcacatagatca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gatctatgtgaatcctaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttaggattcacatagatc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atctatgtgaatcctaagt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct acttaggattcacatagat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tctatgtgaatcctaagta 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tacttaggattcacataga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tctataattttcaggacca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tggtcctgaaaattataga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ctataattttcaggaccac 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gtggtcctgaaaattatag 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct attttcaggaccacagact 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agtctgtggtcctgaaaat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttcaggaccacagactaag 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cttagtctgtggtcctgaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tcaggaccacagactaagc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gcttagtctgtggtcctga 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttttagggccagaatacca 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tggtattctggccctaaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tttagggccagaataccaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttggtattctggccctaaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttagggccagaataccaaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct tttggtattctggccctaa 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tagggccagaataccaaaa 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ttttggtattctggcccta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agggccagaataccaaaat 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct attttggtattctggccct 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gggccagaataccaaaatg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct cattttggtattctggccc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ggccagaataccaaaatgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccattttggtattctggcc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ccagaataccaaaatggct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agccattttggtattctgg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct cagaataccaaaatggctc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gagccattttggtattctg 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct taccaaaatggctcctctc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gagaggagccattttggta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct accaaaatggctcctctct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct agagaggagccattttggt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct taatatatgagttgcttcc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ggaagcaactcatatatta 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct aatatatgagttgcttcct 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aggaagcaactcatatatt 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct atatatgagttgcttcctc 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct gaggaagcaactcatatat 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct tgagttgcttcctctattt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aaatagaggaagcaactca 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gagttgcttcctctatttg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct caaatagaggaagcaactc 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct agttgcttcctctatttgg 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct ccaaatagaggaagcaact 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct gttgcttcctctatttggt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct accaaatagaggaagcaac 19 RNA PAT misc_feature 1..19 note sense sequence source 1..19 mol_type other RNA organism synthetic construct ttgcttcctctatttggtt 19 RNA PAT misc_feature 1..19 note antisense sequence source 1..19 mol_type other RNA organism synthetic construct aaccaaatagaggaagcaa