CN PCT/CN2024/110642 2024-08-08 IEC240212PCT CN 202310997528.X 2023-08-09 XIAMEN UNIVERSITY Citrullinated SETDB1 polypeptide and use thereof in diagnosis of rheumatoid arthritis 15 72 AA PAT source 1..72 mol_type protein note SETDB1 MBD sequence organism synthetic construct YRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCLDPYVL 23 AA PAT source 1..23 mol_type protein note SETDB1 -Arg-4 amino acid sequence (aa5-27) organism synthetic construct NPLLVPLLYDFRRMTARRRVNRK 23 AA PAT source 1..23 mol_type protein note SETDB1 -cit-4 amino acid sequence (aa5-27) organism synthetic construct MOD_RES 12..13 note citrulline MOD_RES 17..19 note citrulline MOD_RES 22 note citrulline NPLLVPLLYDFXXMTAXXXVNXK 20 AA PAT source 1..20 mol_type protein note SETDB1 -cit-4-truncated 1# amino acid sequence (aa8-27) organism synthetic construct MOD_RES 9..10 note citrulline MOD_RES 14..16 note citrulline MOD_RES 19 note citrulline LVPLLYDFXXMTAXXXVNXK 16 AA PAT source 1..16 mol_type protein note SETDB1 -cit-4-truncated 2# amino acid sequence (aa12-27) organism synthetic construct MOD_RES 5..6 note citrulline MOD_RES 10..12 note citrulline MOD_RES 15 note citrulline LYDFXXMTAXXXVNXK 14 AA PAT source 1..14 mol_type protein note SETDB1 -cit-4-truncated 3# amino acid sequence (aa14-27) organism synthetic construct MOD_RES 3..4 note citrulline MOD_RES 8..10 note citrulline MOD_RES 13 note citrulline DFXXMTAXXXVNXK 12 AA PAT source 1..12 mol_type protein note SETDB1 -cit-4-truncated 4# amino acid sequence (aa16-27) organism synthetic construct MOD_RES 1..2 note citrulline MOD_RES 6..8 note citrulline MOD_RES 11 note citrulline XXMTAXXXVNXK 11 AA PAT source 1..11 mol_type protein note SETDB1 -cit-4-truncated 5# amino acid sequence (aa16-26) organism synthetic construct MOD_RES 1..2 note citrulline MOD_RES 6..8 note citrulline MOD_RES 11 note citrulline XXMTAXXXVNX 27 AA PAT source 1..27 mol_type protein note SETDB1 -cit-4-lengthened 1# amino acid sequence (aa1-27) organism synthetic construct MOD_RES 2 note citrulline MOD_RES 16..17 note citrulline MOD_RES 21..23 note citrulline MOD_RES 26 note citrulline YXGKNPLLVPLLYDFXXMTAXXXVNXK 28 AA PAT source 1..28 mol_type protein note SETDB1 -cit-4-lengthened 2# amino acid sequence (aa5-32) organism synthetic construct MOD_RES 12..13 note citrulline MOD_RES 17..19 note citrulline MOD_RES 22 note citrulline NPLLVPLLYDFXXMTAXXXVNXKMGFHV 13 AA PAT source 1..13 mol_type protein note cit-2 amino acid sequence organism synthetic construct MOD_RES 8 note citrulline EVKGPSGXSFCCE 25 AA PAT source 1..25 mol_type protein note cit-3 amino acid sequence organism synthetic construct MOD_RES 6 note citrulline MOD_RES 11..12 note citrulline MOD_RES 21 note citrulline MOD_RES 23 note citrulline NMSVTXSNSLXXDSPPPPARXAXQE 13 AA PAT source 1..13 mol_type protein note cit-5 amino acid sequence organism synthetic construct MOD_RES 2 note citrulline MOD_RES 8..10 note citrulline MOD_RES 12 note citrulline PXMQIICXXXWXE 10 AA PAT source 1..10 mol_type protein note cit-8 amino acid sequence organism synthetic construct MOD_RES 4 note citrulline MOD_RES 5 note citrulline ADMXXQMFAE 11 AA PAT source 1..11 mol_type protein note cit-9 amino acid sequence organism synthetic construct MOD_RES 7 note citrulline MOD_RES 8 note citrulline MOD_RES 10 note citrulline MGPGDFXXCXE