OPA23281 KR 10-2022-0183262 2022-12-23 HANMI PHARM. CO., LTD. PHARMACEUTICAL COMPOSITION FOR THE PREVENTION OR TREATMENT OF GRAFT-VERSUS-HOST DISEASE CONTAINING GLP-2 DERIVATIVE OR LONG-ACTING CONJUGATE THEREOF 34 33 AA PAT source 1..33 mol_type protein organism Homo sapiens HADGSFSDEMNTILDNLAARDFINWLIQTKITD 34 AA PAT REGION 1..34 note GLP-2 derivative SITE 1 note X is imidazoacetyldeshistidine source 1..34 mol_type protein organism synthetic construct XGDGSFSDEMNTILDNLAARDFINWLIQTKITDC 34 AA PAT REGION 1..34 note GLP-2 derivative SITE 1 note X is imidazoacetyldeshistidine source 1..34 mol_type protein organism synthetic construct XGDGSFSDEMNTILDNLAARDFINWLIQTKITDK 34 AA PAT REGION 1..34 note GLP-2 derivative SITE 1 note X is imidazoacetyldeshistidine source 1..34 mol_type protein organism synthetic construct XGDGSFSDEMNTILDNLAARDFINWLIQTRITDK 34 AA PAT REGION 1..34 note GLP-2 derivative SITE 1 note X is imidazoacetyldeshistidine SITE 34 note X is 6-azidolysine source 1..34 mol_type protein organism synthetic construct XGDGSFSDEMNTILDNLAARDFINWLIQTKITDX 34 AA PAT REGION 1..34 note GLP-2 derivative SITE 1 note X is imidazoacetyldeshistidine source 1..34 mol_type protein organism synthetic construct XGDGSFSDEMNTILDNLAARDFINWLIQTRITDC 34 AA PAT REGION 1..34 note GLP-2 derivative SITE 1 note X is imidazoacetyldeshistidine SITE 2 note X is Aib(2-aminoisobutyric acid) source 1..34 mol_type protein organism synthetic construct XXDGSFSDEMNTILDNLAARDFINWLIQTKITDC 34 AA PAT REGION 1..34 note GLP-2 derivative SITE 2 note X is Aib(2-aminoisobutyric acid) source 1..34 mol_type protein organism synthetic construct HXDGSFSDEMNTILDNLAARDFINWLIQTKITDC 34 AA PAT REGION 1..34 note GLP-2 derivative SITE 1 note X is Histidine, imidazoacetyldeshistidine, desaminohistidine, beta-hydroxyimidazopropionyldeshistidine, N-dimethylhistidine, or beta-carboxyimidazopropionyldeshistidine SITE 2 note X is Alanine, Glycine, or Aib(2-aminoisobutyric acid) SITE 30 note X is Lysine, or Arginine SITE 34 note X is absent, Lysine, Arginine, Glutamine, Histidine, 6-azidolysine, or Cysteine source 1..34 mol_type protein organism synthetic construct XXDGSFSDEMNTILDNLAARDFINWLIQTXITDX 34 AA PAT REGION 1..34 note GLP-2 derivative SITE 1 note X is Histidine, imidazoacetyldeshistidine, desaminohistidine, beta-hydroxyimidazopropionyldeshistidine, N-dimethylhistidine, or beta-carboxyimidazopropionyldeshistidine SITE 2 note X is Alanine, Glycine, or Aib(2-aminoisobutyric acid) SITE 30 note X is Lysine, or Arginine SITE 34 note X is any one or more amino acid or any one or more amino acid which is modified source 1..34 mol_type protein organism synthetic construct XXDGSFSDEMNTILDNLAARDFINWLIQTXITDX 12 AA PAT source 1..12 mol_type protein organism Homo sapiens ESKYGPPCPSCP 11 AA PAT REGION 1..11 note Variant of hinge region source 1..11 mol_type protein organism synthetic construct ESKYGPPPSCP 11 AA PAT REGION 1..11 note Variant of hinge region source 1..11 mol_type protein organism synthetic construct ESKYGPPCPSP 10 AA PAT REGION 1..10 note Variant of hinge region source 1..10 mol_type protein organism synthetic construct ESKYGPPCPS 10 AA PAT REGION 1..10 note Variant of hinge region source 1..10 mol_type protein organism synthetic construct ESKYGPPCPP 8 AA PAT REGION 1..8 note Variant of hinge region source 1..8 mol_type protein organism synthetic construct KYGPPCPS 8 AA PAT REGION 1..8 note Variant of hinge region source 1..8 mol_type protein organism synthetic construct ESKYGPPC 7 AA PAT REGION 1..7 note Variant of hinge region source 1..7 mol_type protein organism synthetic construct EKYGPPC 6 AA PAT REGION 1..6 note Variant of hinge region source 1..6 mol_type protein organism synthetic construct ESPSCP 5 AA PAT REGION 1..5 note Variant of hinge region source 1..5 mol_type protein organism synthetic construct EPSCP 4 AA PAT REGION 1..4 note Variant of hinge region source 1..4 mol_type protein organism synthetic construct PSCP 10 AA PAT REGION 1..10 note Variant of hinge region source 1..10 mol_type protein organism synthetic construct ESKYGPPSCP 9 AA PAT REGION 1..9 note Variant of hinge region source 1..9 mol_type protein organism synthetic construct KYGPPPSCP 9 AA PAT REGION 1..9 note Variant of hinge region source 1..9 mol_type protein organism synthetic construct ESKYGPSCP 8 AA PAT REGION 1..8 note Variant of hinge region source 1..8 mol_type protein organism synthetic construct ESKYGPPC 7 AA PAT REGION 1..7 note Variant of hinge region source 1..7 mol_type protein organism synthetic construct KYGPPCP 7 AA PAT REGION 1..7 note Variant of hinge region source 1..7 mol_type protein organism synthetic construct ESKPSCP 6 AA PAT REGION 1..6 note Variant of hinge region source 1..6 mol_type protein organism synthetic construct ESPSCP 4 AA PAT REGION 1..4 note Variant of hinge region source 1..4 mol_type protein organism synthetic construct EPSC 000 221 AA PAT source 1..221 mol_type protein organism Homo sapiens PSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 442 AA PAT REGION 1..442 note Human Immunoglobulin G4 Fc Fragment (homodimer) REGION 1..221 note Amino acids at position 1 to 221 form one monomer. REGION 222..442 note Amino acids at position 222 to 442 form one monomer. DISULFID 3..224 note Amino acids at position 3 and position 224 form an inter-disulfide bond DISULFID 35..95 note Amino acids at position 35 and position 95 form an intra-chain disulfide bond. DISULFID 141..199 note Amino acids at position 141 and position 199 form an intra-chain disulfide bond. DISULFID 256..316 note Amino acids at position 256 and position 316 form an intra-chain disulfide bond. DISULFID 362..420 note Amino acids at position 362 and position 420 form an intra-chain disulfide bond source 1..442 mol_type protein organism Homo sapiens PSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 4 AA PAT source 1..4 mol_type protein note Linker organism synthetic construct GGGS 5 AA PAT source 1..5 mol_type protein note Linker organism synthetic construct GGGGS