23F00024 JP 2023-064440 2023-04-11 FUJIFILM Corporation METHOD FOR PREPARING POLYPEPTIDE SOLUTION FOR EVALUATING PHYSIOLOGICAL ACTIVITY AND METHOD FOR EVALUATING PHYSIOLOGICAL ACTIVITY OF POLYPEPTIDE 132 123 DNA PAT source 1..123 mol_type other DNA organism synthetic construct gttgtaaaacgacggccagtgccaagcttgggctaatacgactcactatagggagagtagttcaatggtagaacgtcggtctctaaaaccgagcgttgagggttcgattcctttctctcccac 41 AA PAT source 1..41 mol_type protein organism synthetic construct MOD_RES 40 note chloroacetylated lysine MOD_RES 19 note chloroacetylated lysine HCSYERLQFHGHEAPFRVKVSHCSYERLQFHGHEAPFRVKV 6 AA PAT source 1..6 mol_type protein organism synthetic construct VKKTKT 11 AA PAT source 1..11 mol_type protein organism synthetic construct VSGWRLFKKIS 12 AA PAT source 1..12 mol_type protein organism synthetic construct GVAMPGAEDDVV 8 AA PAT source 1..8 mol_type protein organism synthetic construct DYKDDDDK 9 AA PAT source 1..9 mol_type protein organism synthetic construct YPYDVPDYA 6 AA PAT source 1..6 mol_type protein organism synthetic construct HHHHHH 10 AA PAT source 1..10 mol_type protein organism synthetic construct EQKLISEEDL 8 AA PAT source 1..8 mol_type protein organism synthetic construct WSHPQFEK 77 AA PAT MOD_RES 26 note chloroacetylated lysine source 1..77 mol_type protein organism synthetic construct MOD_RES 47 note chloroacetylated lysine MVKKTKTHCSYERLQFHGHEAPFRVKVSHCSYERLQFHGHEAPFRVKVGSGVSGWRLFKKISSGSGVAMPGAEDDVV 73 AA PAT source 1..73 mol_type protein organism synthetic construct MOD_RES 47 note chloroacetylated lysine MOD_RES 26 note chloroacetylated lysine MVKKTKTHCSYERLQFHGHEAPFRVKVSHCSYERLQFHGHEAPFRVKVGSGVSGWRLFKKISSGSDYKDDDDK 74 AA PAT MOD_RES 47 note chloroacetylated lysine source 1..74 mol_type protein organism synthetic construct MOD_RES 26 note chloroacetylated lysine MVKKTKTHCSYERLQFHGHEAPFRVKVSHCSYERLQFHGHEAPFRVKVGSGVSGWRLFKKISSGSYPYDVPDYA 71 AA PAT source 1..71 mol_type protein organism synthetic construct MOD_RES 26 note chloroacetylated lysine MOD_RES 47 note chloroacetylated lysine MVKKTKTHCSYERLQFHGHEAPFRVKVSHCSYERLQFHGHEAPFRVKVGSGVSGWRLFKKISSGSHHHHHH 75 AA PAT MOD_RES 26 note chloroacetylated lysine MOD_RES 47 note chloroacetylated lysine source 1..75 mol_type protein organism synthetic construct MVKKTKTHCSYERLQFHGHEAPFRVKVSHCSYERLQFHGHEAPFRVKVGSGVSGWRLFKKISSGSEQKLISEEDL 73 AA PAT MOD_RES 26 note chloroacetylated lysine MOD_RES 47 note chloroacetylated lysine source 1..73 mol_type protein organism synthetic construct MVKKTKTHCSYERLQFHGHEAPFRVKVSHCSYERLQFHGHEAPFRVKVGSGVSGWRLFKKISSGSWSHPQFEK 322 DNA PAT source 1..322 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatataccaatggttaaaaaaacaaaaacacattgctcttacgaacgtctgcagttccatggtcatgaagctccgttccgtgtttaggtttcgcactgtagctatgagcgcttgcaatttcacggccacgaggcaccctttcgcgtataggtaggaagtggtgtaagtggatggcgattattcaagaagattagcagcggcagtggagttgcaatgcctggtgcagaagatgatgtagtataatga 310 DNA PAT source 1..310 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatataccaatggttaaaaaaacaaaaacacattgctcttacgaacgtctgcagttccatggtcatgaagctccgttccgtgtttaggtttcgcactgtagctatgagcgcttgcaatttcacggccacgaggcaccctttcgcgtataggtaggaagtggtgtaagtggatggcgattattcaagaagattagcagcggcagtgactacaaagacgacgacgacaaataatga 313 DNA PAT source 1..313 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatataccaatggttaaaaaaacaaaaacacattgctcttacgaacgtctgcagttccatggtcatgaagctccgttccgtgtttaggtttcgcactgtagctatgagcgcttgcaatttcacggccacgaggcaccctttcgcgtataggtaggaagtggtgtaagtggatggcgattattcaagaagattagcagcggcagttacccgtacgacgttccggactacgcttaatga 304 DNA PAT source 1..304 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatataccaatggttaaaaaaacaaaaacacattgctcttacgaacgtctgcagttccatggtcatgaagctccgttccgtgtttaggtttcgcactgtagctatgagcgcttgcaatttcacggccacgaggcaccctttcgcgtataggtaggaagtggtgtaagtggatggcgattattcaagaagattagcagcggcagtcatcatcatcatcatcattaatga 316 DNA PAT source 1..316 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatataccaatggttaaaaaaacaaaaacacattgctcttacgaacgtctgcagttccatggtcatgaagctccgttccgtgtttaggtttcgcactgtagctatgagcgcttgcaatttcacggccacgaggcaccctttcgcgtataggtaggaagtggtgtaagtggatggcgattattcaagaagattagcagcggcagtgaacagaaactgatctctgaagaagacctgtaatga 310 DNA PAT source 1..310 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatataccaatggttaaaaaaacaaaaacacattgctcttacgaacgtctgcagttccatggtcatgaagctccgttccgtgtttaggtttcgcactgtagctatgagcgcttgcaatttcacggccacgaggcaccctttcgcgtataggtaggaagtggtgtaagtggatggcgattattcaagaagattagcagcggcagttggtctcatccgcagttcgaaaaataatga 24 DNA PAT source 1..24 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagg 18 DNA PAT source 1..18 mol_type other DNA organism synthetic construct cgaaacctaaacacggaa 105 DNA PAT source 1..105 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatataccaatggttaaaaaaacaaaaac 81 DNA PAT source 1..81 mol_type other DNA organism synthetic construct cgaaacctaaacacggaacggagcttcatgaccatggaactgcagacgttcgtaagagcaatgtgtttttgtttttttaac 29 DNA PAT source 1..29 mol_type other DNA organism synthetic construct tcattatactacatcatcttctgcaccag 19 DNA PAT source 1..19 mol_type other DNA organism synthetic construct tcattatttgtcgtcgtcg 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct tcattaagcgtagtccggaac 22 DNA PAT source 1..22 mol_type other DNA organism synthetic construct tcattaatgatgatgatgatga 27 DNA PAT source 1..27 mol_type other DNA organism synthetic construct tcattacaggtcttcttcagagatcag 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tcattatttttcgaactgcg 160 DNA PAT source 1..160 mol_type other DNA organism synthetic construct catcatcttctgcaccaggcattgcaactccactgccgctgctaatcttcttgaataatcgccatccacttacaccacttcctacctatacgcgaaagggtgcctcgtggccgtgaaattgcaagcgctcatagctacagtgcgaaacctaaacacggaa 159 DNA PAT source 1..159 mol_type other DNA organism synthetic construct tcattatttgtcgtcgtcgtctttgtagtcactgccgctgctaatcttcttgaataatcgccatccacttacaccacttcctacctatacgcgaaagggtgcctcgtggccgtgaaattgcaagcgctcatagctacagtgcgaaacctaaacacggaa 160 DNA PAT source 1..160 mol_type other DNA organism synthetic construct attaagcgtagtccggaacgtcgtacgggtaactgccgctgctaatcttcttgaataatcgccatccacttacaccacttcctacctatacgcgaaagggtgcctcgtggccgtgaaattgcaagcgctcatagctacagtgcgaaacctaaacacggaa 153 DNA PAT source 1..153 mol_type other DNA organism synthetic construct tcattaatgatgatgatgatgatgactgccgctgctaatcttcttgaataatcgccatccacttacaccacttcctacctatacgcgaaagggtgcctcgtggccgtgaaattgcaagcgctcatagctacagtgcgaaacctaaacacggaa 160 DNA PAT source 1..160 mol_type other DNA organism synthetic construct acaggtcttcttcagagatcagtttctgttcactgccgctgctaatcttcttgaataatcgccatccacttacaccacttcctacctatacgcgaaagggtgcctcgtggccgtgaaattgcaagcgctcatagctacagtgcgaaacctaaacacggaa 159 DNA PAT source 1..159 mol_type other DNA organism synthetic construct tcattatttttcgaactgcggatgagaccaactgccgctgctaatcttcttgaataatcgccatccacttacaccacttcctacctatacgcgaaagggtgcctcgtggccgtgaaattgcaagcgctcatagctacagtgcgaaacctaaacacggaa 24 AA PAT source 1..24 mol_type protein organism synthetic construct EQKLISEEDLGGSVSGWRLFKKIS 10 AA PAT source 1..10 mol_type protein organism synthetic construct SITE 7..10 note unsure VKKTKTXXXX 4 AA PAT source 1..4 mol_type protein organism synthetic construct REGION 1..4 note VKKX Tag VKKI 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKK 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKT 4 AA PAT source 1..4 mol_type protein organism synthetic construct REGION 1..4 note VKKX Tag VKKR 4 AA PAT source 1..4 mol_type protein organism synthetic construct REGION 1..4 note VKKX Tag VKKS 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKH 4 AA PAT source 1..4 mol_type protein organism synthetic construct REGION 1..4 note VKKX Tag VKKM 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKP 4 AA PAT source 1..4 mol_type protein organism synthetic construct REGION 1..4 note VKKX Tag VKKG 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKL 4 AA PAT source 1..4 mol_type protein organism synthetic construct REGION 1..4 note VKKX Tag VKKV 4 AA PAT source 1..4 mol_type protein organism synthetic construct REGION 1..4 note VKKX Tag VKKE 4 AA PAT source 1..4 mol_type protein organism synthetic construct REGION 1..4 note VKKX Tag VKKA 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKD 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKC 4 AA PAT source 1..4 mol_type protein organism synthetic construct REGION 1..4 note VKKX Tag VKKN 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKY 4 AA PAT source 1..4 mol_type protein organism synthetic construct REGION 1..4 note VKKX Tag VKKQ 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKW 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKF 6 AA PAT source 1..6 mol_type protein organism synthetic construct REGION 1..6 note VKKX Tag VKKTKT 7 AA PAT source 1..7 mol_type protein organism synthetic construct REGION 1..7 note VKKX Tag VKKTKTT 7 AA PAT source 1..7 mol_type protein organism synthetic construct REGION 1..7 note VKKX Tag VKKTKTD 8 AA PAT REGION 1..8 note VKKX Tag source 1..8 mol_type protein organism synthetic construct VKKTKTKK 8 AA PAT REGION 1..8 note VKKX Tag source 1..8 mol_type protein organism synthetic construct VKKTKTKT 8 AA PAT REGION 1..8 note VKKX Tag source 1..8 mol_type protein organism synthetic construct VKKTKTKD 8 AA PAT REGION 1..8 note VKKX Tag source 1..8 mol_type protein organism synthetic construct VKKTKTTK 8 AA PAT source 1..8 mol_type protein organism synthetic construct REGION 1..8 note VKKX Tag VKKTKTTT 8 AA PAT source 1..8 mol_type protein organism synthetic construct REGION 1..8 note VKKX Tag VKKTKTDD 9 AA PAT source 1..9 mol_type protein organism synthetic construct REGION 1..9 note VKKX Tag VKKTKTKKT 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTKKD 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTKTK 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTKTT 9 AA PAT source 1..9 mol_type protein organism synthetic construct REGION 1..9 note VKKX Tag VKKTKTKDK 9 AA PAT source 1..9 mol_type protein organism synthetic construct REGION 1..9 note VKKX Tag VKKTKTKDT 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTKDD 9 AA PAT source 1..9 mol_type protein organism synthetic construct REGION 1..9 note VKKX Tag VKKTKTTKK 9 AA PAT source 1..9 mol_type protein organism synthetic construct REGION 1..9 note VKKX Tag VKKTKTTKT 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTTKD 10 AA PAT source 1..10 mol_type protein organism synthetic construct REGION 1..10 note VKKX Tag VKKTKTKKTK 10 AA PAT REGION 1..10 note VKKX Tag source 1..10 mol_type protein organism synthetic construct VKKTKTKKDK 10 AA PAT REGION 1..10 note VKKX Tag source 1..10 mol_type protein organism synthetic construct VKKTKTKTKK 10 AA PAT source 1..10 mol_type protein organism synthetic construct REGION 1..10 note VKKX Tag VKKTKTKTTK 10 AA PAT source 1..10 mol_type protein organism synthetic construct REGION 1..10 note VKKX Tag VKKTKTKDKK 10 AA PAT source 1..10 mol_type protein organism synthetic construct REGION 1..10 note VKKX Tag VKKTKTTTKK 11 AA PAT source 1..11 mol_type protein organism synthetic construct REGION 1..11 note VKKX Tag VKKTKTKTDTT 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaaata 12 DNA PAT source 1..12 mol_type other DNA organism synthetic construct misc_feature 1..12 note Code sequence of VKKX Tag gttaaaaaaaaa 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaaaca 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaacgg 12 DNA PAT source 1..12 mol_type other DNA organism synthetic construct misc_feature 1..12 note Code sequence of VKKX Tag gttaaaaaatca 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaacat 12 DNA PAT source 1..12 mol_type other DNA organism synthetic construct misc_feature 1..12 note Code sequence of VKKX Tag gttaaaaaaatg 12 DNA PAT source 1..12 mol_type other DNA organism synthetic construct misc_feature 1..12 note Code sequence of VKKX Tag gttaaaaaacct 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaaggc 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaacta 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaagtt 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaagaa 12 DNA PAT source 1..12 mol_type other DNA organism synthetic construct misc_feature 1..12 note Code sequence of VKKX Tag gttaaaaaagca 12 DNA PAT source 1..12 mol_type other DNA organism synthetic construct misc_feature 1..12 note Code sequence of VKKX Tag gttaaaaaagat 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaatgt 12 DNA PAT source 1..12 mol_type other DNA organism synthetic construct misc_feature 1..12 note Code sequence of VKKX Tag gttaaaaaaaat 12 DNA PAT source 1..12 mol_type other DNA organism synthetic construct misc_feature 1..12 note Code sequence of VKKX Tag gttaaaaaatat 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaacaa 12 DNA PAT source 1..12 mol_type other DNA organism synthetic construct misc_feature 1..12 note Code sequence of VKKX Tag gttaaaaaatgg 12 DNA PAT source 1..12 mol_type other DNA organism synthetic construct misc_feature 1..12 note Code sequence of VKKX Tag gttaaaaaattt 18 DNA PAT misc_feature 1..18 note Code sequence of VKKX Tag source 1..18 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaaca 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct misc_feature 1..21 note Code sequence of VKKX Tag gttaaaaaaacaaaaacaaca 21 DNA PAT misc_feature 1..21 note Code sequence of VKKX Tag source 1..21 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacagat 24 DNA PAT misc_feature 1..24 note Code sequence of VKKX Tag source 1..24 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaaaa 24 DNA PAT source 1..24 mol_type other DNA organism synthetic construct misc_feature 1..24 note Code sequence of VKKX Tag gttaaaaaaacaaaaacaaaaaca 24 DNA PAT misc_feature 1..24 note Code sequence of VKKX Tag source 1..24 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaagat 24 DNA PAT source 1..24 mol_type other DNA organism synthetic construct misc_feature 1..24 note Code sequence of VKKX Tag gttaaaaaaacaaaaacaacaaaa 24 DNA PAT source 1..24 mol_type other DNA organism synthetic construct misc_feature 1..24 note Code sequence of VKKX Tag gttaaaaaaacaaaaacaacaaca 24 DNA PAT misc_feature 1..24 note Code sequence of VKKX Tag source 1..24 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacagatgat 27 DNA PAT source 1..27 mol_type other DNA organism synthetic construct misc_feature 1..27 note Code sequence of VKKX Tage gttaaaaaaacaaaaacaaaaaaaaca 27 DNA PAT source 1..27 mol_type other DNA organism synthetic construct misc_feature 1..27 note Code sequence of VKKX Tag gttaaaaaaacaaaaacaaaaaaagat 27 DNA PAT source 1..27 mol_type other DNA organism synthetic construct misc_feature 1..27 note Code sequence of VKKX Tag gttaaaaaaacaaaaacaaaaacaaaa 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaacaaca 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaagataaa 27 DNA PAT source 1..27 mol_type other DNA organism synthetic construct misc_feature 1..27 note Code sequence of VKKX Tag gttaaaaaaacaaaaacaaaagataca 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaagatgat 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaacaaaaaaa 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaacaaaaaca 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaacaaaagat 30 DNA PAT misc_feature 1..30 note Code sequence of VKKX Tag source 1..30 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaaaaacaaaa 30 DNA PAT misc_feature 1..30 note Code sequence of VKKX Tag source 1..30 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaaaagataaa 30 DNA PAT misc_feature 1..30 note Code sequence of VKKX Tag source 1..30 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaacaaaaaaa 30 DNA PAT misc_feature 1..30 note Code sequence of VKKX Tag source 1..30 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaacaacaaaa 30 DNA PAT source 1..30 mol_type other DNA organism synthetic construct misc_feature 1..30 note Code sequence of VKKX Tag gttaaaaaaacaaaaacaaaagataaaaaa 30 DNA PAT misc_feature 1..30 note Code sequence of VKKX Tag source 1..30 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaacaacaaaaaaa 33 DNA PAT source 1..33 mol_type other DNA organism synthetic construct misc_feature 1..33 note Code sequence of VKKX Tag gttaaaaaaacaaaaacaaaaacagatacaaca