WO P-623495-PC IL 300815 2023-02-20 YEDA RESEARCH AND DEVELOPMENT CO. LTD. Nir LONDON MODIFIED PROTEINS OR PEPTIDES FOR COVALENT TARGETING 38 6 AA PAT REGION 1..6 note Description of sequence: Enzyme: 4QLI_4 source 1..6 mol_type protein organism synthetic construct MOD_RES 3 note T at position 3 is Phosphothreonine MOD_RES 4 note C at position 4 is Methacrylate-modified cysteine SHTCPS 6 AA PAT REGION 1..6 note Description of sequence: Enzyme: 4QLI_5 source 1..6 mol_type protein organism synthetic construct MOD_RES 3 note T at position 3 is Phosphothreonine MOD_RES 5 note C at position 5 is Methacrylate-modified cysteine SHTLCS 8 AA PAT REGION 1..8 note Description of sequence: Enzyme: 4IEA_5 source 1..8 mol_type protein organism synthetic construct MOD_RES 4 note S at position 4 is Phosphoserine MOD_RES 5 note C at position 5 is Methacrylate-modified cysteine RSASCPSL 8 AA PAT REGION 1..8 note Description of sequence: Enzyme: 4IEA_7 source 1..8 mol_type protein organism synthetic construct MOD_RES 4 note S at position 4 is Phosphoserine MOD_RES 7 note C at position 7 is Methacrylate-modified cysteine RSASEPCL 8 AA PAT REGION 1..8 note Description of sequence: Enzyme: 4IEA_8 source 1..8 mol_type protein organism synthetic construct MOD_RES 4 note S at position 4 is Phosphoserine MOD_RES 8 note C at position 8 is Methacrylate-modified cysteine RSASEPSC 6 AA PAT REGION 1..6 note Description of sequence: Enzyme: 3IQU_6 source 1..6 mol_type protein organism synthetic construct MOD_RES 5 note S at position 5 is Phosphoserine MOD_RES 6 note C at position 6 is Methacrylate-modified cysteine QRSTSC 6 AA PAT REGION 1..6 note Description of sequence: Enzyme: 3P1N_6 source 1..6 mol_type protein organism synthetic construct MOD_RES 5 note S at position 5 is Phosphoserine MOD_RES 6 note C at position 6 is Methacrylate-modified cysteine KRRKSC 10 AA PAT REGION 1..10 note Description of sequence: Enzyme: 3MHR_5 source 1..10 mol_type protein organism synthetic construct MOD_RES 4 note S at position 4 is Phosphoserine MOD_RES 5 note C at position 5 is Methacrylate-modified cysteine RAHSCPASLQ 10 AA PAT REGION 1..10 note Description of sequence: Enzyme: 3MHR_7 source 1..10 mol_type protein organism synthetic construct MOD_RES 4 note S at position 4 is Phosphoserine MOD_RES 7 note C at position 7 is Methacrylate-modified cysteine RAHSSPCSLQ 10 AA PAT REGION 1..10 note Description of sequence: Enzyme: 3MHR_8 source 1..10 mol_type protein organism synthetic construct MOD_RES 4 note S at position 4 is Phosphoserine MOD_RES 8 note C at position 8 is Methacrylate-modified cysteine RAHSSPACLQ 10 AA PAT REGION 1..10 note Description of sequence: Enzyme: 3MHR_9 source 1..10 mol_type protein organism synthetic construct MOD_RES 4 note S at position 4 is Phosphoserine MOD_RES 9 note C at position 9 is Methacrylate-modified cysteine RAHSSPASCQ 10 AA PAT REGION 1..10 note Description of sequence: Enzyme: 3MHR_CI source 1..10 mol_type protein organism synthetic construct MOD_RES 4 note S at position 4 is Phosphoserine MOD_RES 10 note X at position 10 is Gamma-chloroacetamido-diaminobutyric acid RAHSSPASLX 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct misc_feature 1..21 note Description of sequence:ImFor gaaatgactgagcaccctagt 30 DNA PAT source 1..30 mol_type other DNA organism synthetic construct misc_feature 1..30 note Description of sequence:ImRev acaaaagtgtgtaaccaatttaaccagttc 22 DNA PAT source 1..22 mol_type other DNA organism synthetic construct misc_feature 1..22 note Description of sequence:Im2For gctaatgcggacacttccagtg 29 DNA PAT source 1..29 mol_type other DNA organism synthetic construct misc_feature 1..29 note Description of sequence:Im2Rev aattgttgttacaagctgtaaaaattcag 23 DNA PAT source 1..23 mol_type other DNA organism synthetic construct misc_feature 1..23 note Description of sequence:Lys55for cgggctgtatgggaagaggtgtc 27 DNA PAT source 1..27 mol_type other DNA organism synthetic construct misc_feature 1..27 note Description of sequence:Lys55rev ccgaaaatcgtcgaagcttttaaattc 27 DNA PAT source 1..27 mol_type other DNA organism synthetic construct misc_feature 1..27 note Description of sequence:Lys81for cgaggttattctccgtttactccaaag 25 DNA PAT source 1..25 mol_type other DNA organism synthetic construct misc_feature 1..25 note Description of sequence:Lys81rev tgaaacactagacttattgcttggg 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct misc_feature 1..21 note Description of sequence:Lys89for cggaatcaacaggtcggaggg 26 DNA PAT source 1..26 mol_type other DNA organism synthetic construct misc_feature 1..26 note Description of sequence:Lys89rev tggagtaaacggagaataaccttttg 27 DNA PAT source 1..27 mol_type other DNA organism synthetic construct misc_feature 1..27 note Description of sequence:Lys97for cgagtctatgaacttcatcatgacaag 18 DNA PAT source 1..18 mol_type other DNA organism synthetic construct misc_feature 1..18 note Description of sequence:Lys97rev tctccctccgacctgttg 23 DNA PAT source 1..23 mol_type other DNA organism synthetic construct misc_feature 1..23 note Description of sequence:Lys125for cggcgacatatcgatattcaccg 24 DNA PAT source 1..24 mol_type other DNA organism synthetic construct misc_feature 1..24 note Description of sequence:Lys125rev aggtgtagtcactcggatattatc 94 AA PAT REGION 1..94 note Description of sequence: Enzyme: modified Im9 mutant source 1..94 mol_type protein organism synthetic construct MOD_RES 41 note C at position 41 is Methacrylate-modified cysteine MELKHSISDYTEAEFLQLVTTIANADTSSEEELVKLVTHFCEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQGLEHHHHHH 275 AA PAT source 1..275 mol_type protein organism synthetic construct REGION 1..275 note his-tagged 14-3-3 sigma SYYHHHHHHDYDIPTTENLYFQGAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS 14 AA PAT source 1..14 mol_type protein organism synthetic construct GAVEKGEELSCEER 9 AA PAT source 1..9 mol_type protein organism synthetic construct GEELSCEER 8 AA PAT source 1..8 mol_type protein organism synthetic construct NLLSVAYK 15 AA PAT source 1..15 mol_type protein organism synthetic construct NLLSVAYKNVVGGQR 7 AA PAT source 1..7 mol_type protein organism synthetic construct VFYLKMK 12 AA PAT source 1..12 mol_type protein organism synthetic construct VFYLKMKGDYYR 7 AA PAT source 1..7 mol_type protein organism synthetic construct MKGDYYR 18 AA PAT source 1..18 mol_type protein organism synthetic construct MKGDYYRYLAEVATGDDK 16 AA PAT source 1..16 mol_type protein organism synthetic construct GDYYRYLAEVATGDDK 10 AA PAT source 1..10 mol_type protein organism synthetic construct MOD_RES 1 note X at position 1 is BODIPY propargylglycine MOD_RES 5 note S at position 5 is Phosphoserine MOD_RES 10 note X at position 10 is diaminobutyric acid XRAHSPASLX