US PCT/US2018/049618 2018-09-05 P000227_WO US US 62/554,530 2017-09-05 GLAdiator BioSciences Inc DELIVERY OF PAYLOADS TO STEM CELLS 6 45 AA PAT REGION 1..45 note Synthetic peptide REGION 6..7 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 14 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 16 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 19..20 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 25..26 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 29 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 32 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 36 note misc_feature - X is gamma-carboxyglutamic acid residue source 1..45 mol_type protein organism synthetic construct ANSLLXXTKQGNLXRXCIXXLCNKXXARXVFXNDPXTDYFYPKYL 46 AA PAT REGION 1..46 note Synthetic peptide REGION 7..8 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 11 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 15 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 17 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 20..21 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 26..27 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 30 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 33 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 35 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 40 note misc_feature - X is gamma-carboxyglutamic acid residue source 1..46 mol_type protein organism synthetic construct AGSYLLXXLFXGNLXKXCYXXICVYXXARXVFXNXVVTDXFWRRYK 45 AA PAT REGION 1..45 note Synthetic peptide REGION 6..7 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 14 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 16 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 19..20 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 25..26 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 29 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 32 note misc_feature - X is gamma-carboxyglutamic acid residue source 1..45 mol_type protein organism synthetic construct ANTFLXXVRKGNLXRXCVXXTCSYXXAFXALXSSTATDVFWAKYT 45 AA PAT REGION 1..45 note Synthetic peptide REGION 6..7 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 14 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 16 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 19..20 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 25..26 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 29 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 35 note misc_feature - X is gamma-carboxyglutamic acid residue source 1..45 mol_type protein organism synthetic construct ANAFLXXLRPGSLXRXCKXXQCSFXXARXIFKDAXRTKLFWISYS 45 AA PAT REGION 1..45 note Synthetic peptide REGION 6..7 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 14 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 16 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 19..20 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 25..26 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 29 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 32 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 35 note misc_feature - X is gamma-carboxyglutamic acid residue source 1..45 mol_type protein organism synthetic construct ANAFLXXLRQGSLXRXCKXXQCSFXXARXIFXDAXRTKLFWISYS 250 AA PAT REGION 1..250 note Synthetic peptide REGION 6..7 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 14 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 16 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 19..20 note misc_feature - X is gamma-carboxyglutamic acid residue REGION 25..26 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 29 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 32 note misc_feature - X is gamma-carboxyglutamic acid residue SITE 36 note misc_feature - X is gamma-carboxyglutamic acid residue source 1..250 mol_type protein organism synthetic construct ANSLLXXTKQGNLXRXCIXXLCNKXXARXVFXNDPXTDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCESRHHHHHH