OPA24220 KR 10-2023-0186003 2023-12-19 HANMI PHARM. CO., LTD. Pharmaceutical Composition Comprising Efpeglenatide and its Dosing Regimens 3 39 AA PAT source 1..39 mol_type protein note The modified residue at position 1 is (imidazol-4-yl)acetic acid organism synthetic construct HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 221 AA PAT source 1..221 mol_type protein organism homo sapiens PSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK 442 AA PAT REGION 1..442 note MISC_FEATURE - Amino acids at position 1 to 442 form Human Immunoglobulin G4 Fc Fragment (homodimer) REGION 1..221 note MISC_FEATURE - Amino acids at position 1 to 221 form one monomer REGION 222..442 note MISC_FEATURE - Amino acids at position 222 to 442 form one monomer DISULFID 3..224 note Amino acids at position 3 and position 224 form an inter-disulfide bond DISULFID 35..95 note Amino acids at position 35 and position 95 form an intra-chain disulfide bond DISULFID 141..199 note Amino acids at position 141 and position 199 form an intra-chain disulfide bond DISULFID 256..316 note Amino acids at position 256 and position 316 form an intra-chain disulfide bond DISULFID 362..420 note Amino acids at position 362 and position 420 form an intra-chain disulfide bond source 1..442 mol_type protein organism Homo sapiens PSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK