FA1511-22321 JP 2022-005132 2022-01-17 DAIICHI SANKYO COMPANY, LIMITED ＴＳＰ１阻害剤 TSP1 inhibitor 166 12 AA PAT REGION 1..12 note Peptide-1 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRXGXNWXRWXC 12 AA PAT REGION 1..12 note Peptide-2 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 2 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XXXGXNWXRWXC 12 AA PAT REGION 1..12 note Peptide-3 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 2 note L-Phenylglycine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XXXGXNWXRWXC 12 AA PAT REGION 1..12 note Peptide-4 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 9 note L-Phenylglycine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRXGXNWXXWXC 12 AA PAT REGION 1..12 note Peptide-5 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 9 note L-4-Pyridylalanine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRXGXNWXXWXC 12 AA PAT REGION 1..12 note Peptide-6 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRXGRNWXVWVC 12 AA PAT REGION 1..12 note Peptide-7 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRXGRNWXVWXC 12 AA PAT REGION 1..12 note Peptide-8 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 2 note L-Tert-Leucine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XXXGRNWXRWXC 12 AA PAT REGION 1..12 note Peptide-9 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRXGXDWXRWXC 12 AA PAT REGION 1..12 note Peptide-10 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRXGRNWXRWXC 12 AA PAT REGION 1..12 note Peptide-11 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRXGRDWXRWXC 12 AA PAT REGION 1..12 note Peptide-12 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 12 note Amidation of C-terminal carboxyl group source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRXGRNWXRWVC 21 AA PAT REGION 1..21 note Peptide-13 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with maleimide XRXGXNWXRWXCGGGGDDDXK 20 AA PAT REGION 1..20 note Peptide-14 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRXGXDWXRWXCGGGGDDXK 19 AA PAT REGION 1..19 note Peptide-15 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..19 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 19 note Lysine side chain is modified with maleimide XRXGXDWXRWXCGGGGDXK 22 AA PAT REGION 1..22 note Peptide-16 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 19 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid REGION 20..21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRXGRDWXRWXCGGGGDDXXXK 22 AA PAT REGION 1..22 note Peptide-17 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine REGION 19..20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 21 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRXGRDWXRWXCGSGSDDXXXK 22 AA PAT REGION 1..22 note Peptide-18 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine REGION 19..20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 21 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRXGRDWXRWXCGGGGDDXXXK 22 AA PAT REGION 1..22 note Peptide-19 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid SITE 21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRXGRDWXRWXCGGGGDDXXXK 22 AA PAT REGION 1..22 note Peptide-20 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine REGION 13..16 note MeGly SITE 19 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid REGION 20..21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRXGRDWXRWXCXXXXDDXXXK 22 AA PAT REGION 1..22 note Peptide-21 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine REGION 13..16 note MeGly SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid SITE 21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRXGRDWXRWXCXXXXDDXXXK 22 AA PAT REGION 1..22 note Peptide-22 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 19 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid REGION 20..21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRXGRDWXRWXCGSGSDDXXXK 22 AA PAT REGION 1..22 note Peptide-23 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid SITE 21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRXGRDWXRWXCGSGSDDXXXK 22 AA PAT REGION 1..22 note Peptide-24 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine REGION 13..16 note MeGly REGION 19..20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 21 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRXGRDWXRWXCXXXXDDXXXK 18 AA PAT REGION 1..18 note Peptide-25 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with maleimide XRSGRNWVVWVCGGGGXK 18 AA PAT REGION 1..18 note Peptide-26 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with maleimide XRSGRNWVRWVCGGGGXK 20 AA PAT REGION 1..20 note Peptide-27 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGDDXK 18 AA PAT REGION 1..18 note Peptide-28 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGXK 20 AA PAT REGION 1..20 note Peptide-29 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGXDDK 20 AA PAT REGION 1..20 note Peptide-30 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine REGION 13..16 note bAla SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWVRWXCXXXXDDXK 20 AA PAT REGION 1..20 note Peptide-31 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine REGION 17..18 note D-Aspartic acid SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGXXXK 20 AA PAT REGION 1..20 note Peptide-32 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine REGION 13..16 note bAla REGION 17..18 note D-Aspartic acid SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWVRWXCXXXXXXXK 18 AA PAT REGION 1..18 note Peptide-33 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with maleimide XRSGRNWXVWXCGGGGXK 20 AA PAT REGION 1..20 note Peptide-34 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGRNWXVWXCGGGGDDXK 19 AA PAT REGION 1..19 note Peptide-35 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..19 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 19 note Amidation of C-terminal carboxyl group SITE 19 note Lysine side chain is modified with maleimide XRSGXDWVRWXCGGGGDXK 18 AA PAT REGION 1..18 note Peptide-36 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Lysine side chain is modified with maleimide XRSGXDWVRWXCGGGGXK 18 AA PAT REGION 1..18 note Peptide-37 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with maleimide XRSGXNWXVWXCGGGGXK 20 AA PAT REGION 1..20 note Peptide-38 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWXVWXCGGGGDDXK 20 AA PAT REGION 1..20 note Peptide-39 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGDDXK 19 AA PAT REGION 1..19 note Peptide-40 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Cyclopentylglycine SITE 18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..19 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 19 note Amidation of C-terminal carboxyl group SITE 19 note Lysine side chain is modified with maleimide XRSGXDWXRWXCGGGGDXK 20 AA PAT REGION 1..20 note Peptide-41 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGXDDK 19 AA PAT REGION 1..19 note Peptide-42 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..19 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 19 note Amidation of C-terminal carboxyl group SITE 19 note Lysine side chain is modified with maleimide XRSGXDWXRWXCGGGGXDK 20 AA PAT REGION 1..20 note Peptide-43 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGDDXK 21 AA PAT REGION 1..21 note Peptide-44 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine REGION 19..20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGDDXXK 21 AA PAT REGION 1..21 note Peptide-45 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine REGION 13..16 note MeGly REGION 19..20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with maleimide XRSGXNWXRWXCXXXXDDXXK 21 AA PAT REGION 1..21 note Peptide-46 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine REGION 19..20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGSGSDDXXK 21 AA PAT REGION 1..21 note Peptide-47 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine REGION 19..20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGEGGEXXK 21 AA PAT REGION 1..21 note Peptide-48 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGDXDXK 21 AA PAT REGION 1..21 note Peptide-49 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine REGION 18..19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGDXXDK 21 AA PAT REGION 1..21 note Peptide-50 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGXDXDK 22 AA PAT REGION 1..22 note Peptide-51 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid REGION 20..21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGDDXXXK 22 AA PAT REGION 1..22 note Peptide-52 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid SITE 21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGDDXXXK 22 AA PAT REGION 1..22 note Peptide-53 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine REGION 19..20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 21 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGDDXXXK 22 AA PAT REGION 1..22 note Peptide-54 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 19 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid REGION 20..21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGDDXXXK 22 AA PAT REGION 1..22 note Peptide-55 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid SITE 21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGDDXXXK 22 AA PAT REGION 1..22 note Peptide-56 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine REGION 19..20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 21 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGDDXXXK 21 AA PAT REGION 1..21 note Peptide-57 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 18 note 3-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note 3-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGDXDXK 21 AA PAT REGION 1..21 note Peptide-58 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note 3-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGXDDXK 21 AA PAT REGION 1..21 note Peptide-59 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 19 note 3-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGXDXDK 22 AA PAT REGION 1..22 note Peptide-60 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note (2R,4S,5R,6R)-5-acetamido-2-[[(2R,3R,4S,5R,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2S,3S,4S,5S,6R)-2-[[(2R,3R,4S,5S,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2R,3S,4R,5R,6R)-5-acetamido-6-[2-[[(5S)-5-amino-5-carboxy-pentyl]amino]-2-oxo-ethoxy]-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-[(2R,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4S,5R,6R)-6-[[(2R,4S,5R,6R)-5-acetamido-2-carboxy-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-yl]oxymethyl]-3,4,5-trihydroxy-tetrahydropyran-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-3,5-dihydroxy-tetrahydropyran-2-yl]methoxy]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-yl]methoxy]-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-carboxylic acid REGION 20..21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGDDXXXK 22 AA PAT REGION 1..22 note Peptide-61 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note (2R,4S,5R,6R)-5-acetamido-2-[[(2R,3R,4S,5R,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2S,3S,4S,5S,6R)-2-[[(2R,3R,4S,5S,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2R,3S,4R,5R,6R)-5-acetamido-6-[2-[[(5S)-5-amino-5-carboxy-pentyl]amino]-2-oxo-ethoxy]-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-[(2R,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4S,5R,6R)-6-[[(2R,4S,5R,6R)-5-acetamido-2-carboxy-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-yl]oxymethyl]-3,4,5-trihydroxy-tetrahydropyran-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-3,5-dihydroxy-tetrahydropyran-2-yl]methoxy]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-yl]methoxy]-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-carboxylic acid SITE 21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGDDXXXK 20 AA PAT REGION 1..20 note Peptide-62 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 17 note (2R,4S,5R,6R)-5-acetamido-2-[[(2R,3R,4S,5R,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2S,3S,4S,5S,6R)-2-[[(2R,3R,4S,5S,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2R,3S,4R,5R,6R)-5-acetamido-6-[2-[[(5S)-5-amino-5-carboxy-pentyl]amino]-2-oxo-ethoxy]-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-[(2R,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4S,5R,6R)-6-[[(2R,4S,5R,6R)-5-acetamido-2-carboxy-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-yl]oxymethyl]-3,4,5-trihydroxy-tetrahydropyran-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-3,5-dihydroxy-tetrahydropyran-2-yl]methoxy]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-yl]methoxy]-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-carboxylic acid REGION 18..19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGXXXK 20 AA PAT REGION 1..20 note Peptide-63 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 18 note (2R,4S,5R,6R)-5-acetamido-2-[[(2R,3R,4S,5R,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2S,3S,4S,5S,6R)-2-[[(2R,3R,4S,5S,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2R,3S,4R,5R,6R)-5-acetamido-6-[2-[[(5S)-5-amino-5-carboxy-pentyl]amino]-2-oxo-ethoxy]-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-[(2R,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4S,5R,6R)-6-[[(2R,4S,5R,6R)-5-acetamido-2-carboxy-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-yl]oxymethyl]-3,4,5-trihydroxy-tetrahydropyran-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-3,5-dihydroxy-tetrahydropyran-2-yl]methoxy]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-yl]methoxy]-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-carboxylic acid SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGXXXK 20 AA PAT REGION 1..20 note Peptide-64 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine REGION 17..18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 19 note (2R,4S,5R,6R)-5-acetamido-2-[[(2R,3R,4S,5R,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2S,3S,4S,5S,6R)-2-[[(2R,3R,4S,5S,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2R,3S,4R,5R,6R)-5-acetamido-6-[2-[[(5S)-5-amino-5-carboxy-pentyl]amino]-2-oxo-ethoxy]-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-[(2R,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4S,5R,6R)-6-[[(2R,4S,5R,6R)-5-acetamido-2-carboxy-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-yl]oxymethyl]-3,4,5-trihydroxy-tetrahydropyran-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-3,5-dihydroxy-tetrahydropyran-2-yl]methoxy]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-yl]methoxy]-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-carboxylic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGGGGXXXK 22 AA PAT REGION 1..22 note Peptide-65 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 19 note (2R,4S,5R,6R)-5-acetamido-2-[[(2R,3R,4S,5R,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2S,3S,4S,5S,6R)-2-[[(2R,3R,4S,5S,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2R,3S,4R,5R,6R)-5-acetamido-6-[2-[[(5S)-5-amino-5-carboxy-pentyl]amino]-2-oxo-ethoxy]-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-[(2R,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4S,5R,6R)-6-[[(2R,4S,5R,6R)-5-acetamido-2-carboxy-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-yl]oxymethyl]-3,4,5-trihydroxy-tetrahydropyran-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-3,5-dihydroxy-tetrahydropyran-2-yl]methoxy]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-yl]methoxy]-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-carboxylic acid REGION 20..21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGDDXXXK 22 AA PAT REGION 1..22 note Peptide-66 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note (2R,4S,5R,6R)-5-acetamido-2-[[(2R,3R,4S,5R,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2S,3S,4S,5S,6R)-2-[[(2R,3R,4S,5S,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2R,3S,4R,5R,6R)-5-acetamido-6-[2-[[(5S)-5-amino-5-carboxy-pentyl]amino]-2-oxo-ethoxy]-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-[(2R,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4S,5R,6R)-6-[[(2R,4S,5R,6R)-5-acetamido-2-carboxy-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-yl]oxymethyl]-3,4,5-trihydroxy-tetrahydropyran-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-3,5-dihydroxy-tetrahydropyran-2-yl]methoxy]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-yl]methoxy]-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-carboxylic acid SITE 21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGDDXXXK 22 AA PAT REGION 1..22 note Peptide-67 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine REGION 19..20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 21 note (2R,4S,5R,6R)-5-acetamido-2-[[(2R,3R,4S,5R,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2S,3S,4S,5S,6R)-2-[[(2R,3R,4S,5S,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2R,3S,4R,5R,6R)-5-acetamido-6-[2-[[(5S)-5-amino-5-carboxy-pentyl]amino]-2-oxo-ethoxy]-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-[(2R,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4S,5R,6R)-6-[[(2R,4S,5R,6R)-5-acetamido-2-carboxy-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-yl]oxymethyl]-3,4,5-trihydroxy-tetrahydropyran-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-3,5-dihydroxy-tetrahydropyran-2-yl]methoxy]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-yl]methoxy]-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-carboxylic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGDDXXXK 20 AA PAT REGION 1..20 note Peptide-68 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 17 note (2R,4S,5R,6R)-5-acetamido-2-[[(2R,3R,4S,5R,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2S,3S,4S,5S,6R)-2-[[(2R,3R,4S,5S,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2R,3S,4R,5R,6R)-5-acetamido-6-[2-[[(5S)-5-amino-5-carboxy-pentyl]amino]-2-oxo-ethoxy]-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-[(2R,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4S,5R,6R)-6-[[(2R,4S,5R,6R)-5-acetamido-2-carboxy-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-yl]oxymethyl]-3,4,5-trihydroxy-tetrahydropyran-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-3,5-dihydroxy-tetrahydropyran-2-yl]methoxy]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-yl]methoxy]-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-carboxylic acid REGION 18..19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGXXXK 20 AA PAT REGION 1..20 note Peptide-69 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 18 note (2R,4S,5R,6R)-5-acetamido-2-[[(2R,3R,4S,5R,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2S,3S,4S,5S,6R)-2-[[(2R,3R,4S,5S,6S)-6-[(2R,3S,4R,5R,6S)-5-acetamido-6-[(2R,3S,4R,5R,6R)-5-acetamido-6-[2-[[(5S)-5-amino-5-carboxy-pentyl]amino]-2-oxo-ethoxy]-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-[(2R,3S,4S,5S,6R)-3-[(2S,3R,4R,5S,6R)-3-acetamido-5-[(2S,3R,4S,5R,6R)-6-[[(2R,4S,5R,6R)-5-acetamido-2-carboxy-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-yl]oxymethyl]-3,4,5-trihydroxy-tetrahydropyran-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-2-yl]oxy-3,5-dihydroxy-tetrahydropyran-2-yl]methoxy]-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]oxy-4-hydroxy-2-(hydroxymethyl)tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-yl]methoxy]-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]tetrahydropyran-2-carboxylic acid SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with maleimide XRSGXNWVRWXCGGGGXXXK 22 AA PAT REGION 1..22 note Peptide-70 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine REGION 13..16 note MeGly SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid SITE 21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWXRWXCXXXXDDXXXK 22 AA PAT REGION 1..22 note Peptide-71 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid REGION 20..21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGSGSDDXXXK 22 AA PAT REGION 1..22 note Peptide-72 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid SITE 20 note (2S)-6-amino-2-[[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-methoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]acetyl]amino]hexanoic acid SITE 21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with maleimide XRSGXNWXRWXCGSGSDDXXXK 18 AA PAT REGION 1..18 note Peptide-73 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with DBCO XRSGRNWVVWVCGGGGXK 18 AA PAT REGION 1..18 note Peptide-74 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with DBCO XRSGXNWVRWXCGGGGXK 20 AA PAT REGION 1..20 note Peptide-75 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGXNWVRWXCGGGGDDXK 20 AA PAT REGION 1..20 note Peptide-76 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRXGRDWXRWXCGGGGDDXK 21 AA PAT REGION 1..21 note Peptide-77 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with DBCO XRXGXNWXRWXCGGGGDDDXK 20 AA PAT REGION 1..20 note Peptide-78 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRXGXDWXRWXCGGGGDDXK 20 AA PAT REGION 1..20 note Peptide-79 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGXNWXRWXCGGGGDDXK 21 AA PAT REGION 1..21 note Peptide-80 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with DBCO XRSGRNWVVWVCGGGGDDDXK 18 AA PAT REGION 1..18 note Peptide-81 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with DBCO XRSGRNWVRWXCGGGGXK 30 AA PAT REGION 1..18 note Peptide-82 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 17..29 note MeGly source 1..30 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 30 note Amidation of C-terminal carboxyl group SITE 30 note Lysine side chain is modified with DBCO XRSGRNWVVWVCGGGGXXXXXXXXXXXXXK 18 AA PAT REGION 1..18 note Peptide-83 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 9 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with DBCO XRSGRDWVXWXCGGGGXK 18 AA PAT REGION 1..18 note Peptide-84 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with DBCO XRXGRNWXVWVCGGGGXK 18 AA PAT REGION 1..18 note Peptide-85 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 8 note Nle SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with DBCO XRSGRNWXVWXCGGGGXK 18 AA PAT REGION 1..18 note Peptide-86 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with DBCO XRXGXNWXRWXCGGGGXK 18 AA PAT REGION 1..18 note Peptide-87 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 2 note L-Tert-Leucine SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with DBCO XXSGRNWVRWXCGGGGXK 22 AA PAT REGION 1..22 note Peptide-88 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 21 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..22 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 22 note Amidation of C-terminal carboxyl group SITE 22 note Lysine side chain is modified with DBCO XRSGXNWVRWXCGGGGDDDDXK 21 AA PAT REGION 1..21 note Peptide-89 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 20 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..21 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 21 note Amidation of C-terminal carboxyl group SITE 21 note Lysine side chain is modified with DBCO XRSGXNWVRWXCGGGGDDDXK 20 AA PAT REGION 1..20 note Peptide-90 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGXNWVRWXCGGGGDXDK 20 AA PAT REGION 1..20 note Peptide-91 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGXNWVRWXCGGGGDDXK 20 AA PAT REGION 1..20 note Peptide-92 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRXGXNWXRWXCGGGGDDXK 19 AA PAT REGION 1..19 note Peptide-93 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..19 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 19 note Amidation of C-terminal carboxyl group SITE 19 note Lysine side chain is modified with DBCO XRXGXNWXRWXCGGGGDXK 20 AA PAT REGION 1..20 note Peptide-94 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRXGXNWXRWXCGGGGDXDK 20 AA PAT REGION 1..20 note Peptide-95 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGRNWVRWXCGGGGDDXK 19 AA PAT REGION 1..19 note Peptide-96 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine SITE 18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..19 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 19 note Amidation of C-terminal carboxyl group SITE 19 note Lysine side chain is modified with DBCO XRSGRDWVRWXCGGGGDXK 19 AA PAT REGION 1..19 note Peptide-97 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine SITE 18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..19 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 19 note Lysine side chain is modified with DBCO XRSGRNWVRWXCGGGGDXK 20 AA PAT REGION 1..20 note Peptide-98 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGRNWVRWXCGGEGGEXK 20 AA PAT REGION 1..20 note Peptide-99 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 20 note Lysine side chain is modified with DBCO XRXGRNWXRWXCGGGGDDXK 20 AA PAT REGION 1..20 note Peptide-100 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGXNWVRWXCGGGGXDDK 20 AA PAT REGION 1..20 note Peptide-101 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine REGION 13..16 note bAla SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGXNWVRWXCXXXXDDXK 20 AA PAT REGION 1..20 note Peptide-102 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine REGION 17..18 note D-Aspartic acid SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGXNWVRWXCGGGGXXXK 20 AA PAT REGION 1..20 note Peptide-103 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine REGION 13..16 note bAla REGION 17..18 note D-Aspartic acid SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGXNWVRWXCXXXXXXXK 18 AA PAT REGION 1..18 note Peptide-104 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Amidation of C-terminal carboxyl group SITE 18 note Lysine side chain is modified with DBCO XRSGRNWXVWXCGGGGXK 20 AA PAT REGION 1..20 note Peptide-105 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGRNWXVWXCGGGGDDXK 19 AA PAT REGION 1..19 note Peptide-106 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..19 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 19 note Amidation of C-terminal carboxyl group SITE 19 note Lysine side chain is modified with DBCO XRSGXDWVRWXCGGGGDXK 18 AA PAT REGION 1..18 note Peptide-107 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 17 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..18 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 18 note Lysine side chain is modified with DBCO XRSGXDWVRWXCGGGGXK 19 AA PAT REGION 1..19 note Peptide-108 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 18 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..19 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 19 note Lysine side chain is modified with DBCO XRXGXDWXRWXCGGGGDXK 20 AA PAT REGION 1..20 note Peptide-109 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Cyclopentylglycine SITE 19 note 3-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-Aminoethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid source 1..20 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 20 note Amidation of C-terminal carboxyl group SITE 20 note Lysine side chain is modified with DBCO XRSGXNWXRWXCGGGGDDXK 12 AA PAT REGION 1..12 note Peptide-110 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGRNWVVWVC 12 AA PAT REGION 1..12 note Peptide-111 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGRNWVRWVC 12 AA PAT REGION 1..12 note Peptide-112 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGRNWVRWXC 12 AA PAT REGION 1..12 note Peptide-113 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Cyclopentylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGXNWXRWXC 12 AA PAT REGION 1..12 note Peptide-114 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 8 note Nle SITE 11 note L-Cyclopentylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGRNWXVWXC 12 AA PAT REGION 1..12 note Peptide-115 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGXNWVRWXC 12 AA PAT REGION 1..12 note Peptide-116 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGRNWXVWXC 12 AA PAT REGION 1..12 note Peptide-117 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 2 note L-Tert-Leucine SITE 11 note L-Cyclopentylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XXSGRNWVRWXC 12 AA PAT REGION 1..12 note Peptide-118 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 9 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGRDWVXWXC 12 AA PAT REGION 1..12 note Peptide-119 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Cyclopentylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGXDWVRWXC 12 AA PAT REGION 1..12 note Peptide-120 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGXNWXVWXC 12 AA PAT REGION 1..12 note Peptide-121 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Alpha-cyclohexylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGXNWXRWXC 12 AA PAT REGION 1..12 note Peptide-122 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 11 note L-Alpha-cyclohexylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGXNWVRWXC 12 AA PAT REGION 1..12 note Peptide-123 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 5 note (2S)-2-Amino-4-guanidino-butanoic acid SITE 8 note Nle SITE 11 note L-Cyclopentylglycine SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- XRSGXDWXRWXC 1422 DNA PAT misc_feature 1..1422 note Nucleotide sequence encoding the heavy chain of anti-LPS mAb-A source 1..1422 mol_type other DNA organism synthetic construct CDS 1..1422 note Encoding polypeptides including a signal sequence (19 aa)followed by Heavy chain of mAb-A (20-474: 455 aa) atgaaacacctgtggttcttcctcctgctggtggcagctcccagatgggtgctgagccaggtgcagctggtgcagtctggcgccgaagtgaagaaaccaggcgccagcgtgaaggtgtcctgcaaggccagcggctacacctttaccagctactggatcaactgggtgcgccaggcccctggacagggcctggaatggatgggcaacatctaccccggcagcagcagcatcaactacaacgagaagttcaagagccgcgtgaccatcaccgccgacaccagcacaagcaccgcctacatggaactgagcagcctgcggagcgaggacaccgccgtgtactactgcgcccggaccatctacaactacggcagctccggctacaattacgccatggactactggggccagggcaccctcgtgaccgtgagctcagcctccaccaagggcccaagcgtcttccccctggcaccctcctccaagagcacctctggcggcacagccgccctgggctgcctggtcaaggactacttccccgaacccgtgaccgtgagctggaactcaggcgccctgaccagcggcgtgcacaccttccccgctgtcctgcagtcctcaggactctactccctcagcagcgtggtgaccgtgccctccagcagcttgggcacccagacctacatctgcaacgtgaatcacaagcccagcaacaccaaggtggacaagagagttgagcccaaatcttgtgacaaaactcacacatgcccaccctgcccagcacctgaactcctggggggaccctcagtcttcctcttccccccaaaacccaaggacaccctcatgatctcccggacccctgaggtcacatgcgtggtggtggacgtgagccacgaagaccctgaggtcaagttcaactggtacgtggacggcgtggaggtgcataatgccaagacaaagccccgggaggagcagtacaacagcacgtaccgggtggtcagcgtcctcaccgtcctgcaccaggactggctgaatggcaaggagtacaagtgcaaggtctccaacaaagccctcccagcccccatcgagaaaaccatctccaaagccaaaggccagccccgggaaccacaggtgtacaccctgcccccatcccgggaggagatgaccaagaaccaggtcagcctgacctgcctggtcaaaggcttctatcccagcgacatcgccgtggagtgggagagcaatggccagcccgagaacaactacaagaccacccctcccgtgctggactccgacggctccttcttcctctacagcaagctcaccgtggacaagagcaggtggcagcagggcaacgtcttctcatgctccgtgatgcatgaggctctgcacaaccactacacccagaagagcctctccctgtctcccggcaaa 474 AA PAT REGION 1..474 note Synthetic Construct source 1..474 mol_type protein organism synthetic construct MKHLWFFLLLVAAPRWVLSQVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWINWVRQAPGQGLEWMGNIYPGSSSINYNEKFKSRVTITADTSTSTAYMELSSLRSEDTAVYYCARTIYNYGSSGYNYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 702 DNA PAT misc_feature 1..702 note Nucleotide sequence encoding the light chain of anti-LPS mAb-A source 1..702 mol_type other DNA organism synthetic construct CDS 1..702 note Encoding polypeptides including a signal sequence (20 aa)followed by light chain of mAb-A (21-234: 214 aa) atggtgctgcagacccaggtgttcatctccctgctgctgtggatctccggcgcgtacggcgacatcgtgatgacccagagccctgacagcctggccgtgtctctgggagagagagccaccatcaactgcaaggccagcgagaacgtgggcaacagcgtgtcctggtatcagcagaagcccggccagccccccaagctgctgatctacggcgccagcaacagatacaccggcgtgcccgatagattcagcggcagcggctctggcaccgacttcaccctgacaatcagctccctgcaggccgaggacgtggccgtgtactactgtggccagagctacagctacccctacaccttcggccagggcaccaaggtggaaatcaagcgtacggtggccgccccctccgtgttcatcttccccccctccgacgagcagctgaagtccggcaccgcctccgtggtgtgcctgctgaataacttctaccccagagaggccaaggtgcagtggaaggtggacaacgccctgcagtccgggaactcccaggagagcgtgaccgagcaggacagcaaggacagcacctacagcctgagcagcaccctgaccctgagcaaagccgactacgagaagcacaaggtgtacgcctgcgaggtgacccaccagggcctgagctcccccgtcaccaagagcttcaacaggggggagtgt 234 AA PAT REGION 1..234 note Synthetic Construct source 1..234 mol_type protein organism synthetic construct MVLQTQVFISLLLWISGAYGDIVMTQSPDSLAVSLGERATINCKASENVGNSVSWYQQKPGQPPKLLIYGASNRYTGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCGQSYSYPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 1097 DNA PAT misc_feature 1..1097 note Nucleotide sequence encoding the heavy chain of CLCH-A source 1..1097 mol_type other DNA organism synthetic construct CDS 26..1072 note Encoding polypeptides including a signal sequence (19 aa)followed by CH-A (20-349: 330 aa) ccagcctccggactctagagccaccatgaagcacctgtggttctttctgctgctggtggccgctcccagatgggtgctgagcgcctctacaaagggccccagcgtgttccctctggcccctagcagcaagagcacatctggcggaacagccgccctgggctgcctcgtgaaggactactttcccgagcccgtgaccgtgtcctggaactctggcgctctgacaagcggcgtgcacacctttccagccgtgctgcagagcagcggcctgtactctctgagcagcgtcgtgacagtgcccagcagctctctgggcacccagacctacatctgcaacgtgaaccacaagcccagcaacaccaaggtggacaagcgggtggaacccaagagctgcgacaagacccacacctgtcccccttgtcctgcccccgaactgctgggaggcccttccgtgttcctgttccccccaaagcccaaggacaccctgatgatcagccggacccccgaagtgacctgcgtggtggtggatgtgtcccacgaggaccctgaagtgaagttcaattggtacgtggacggcgtggaagtgcacaacgccaagaccaagcctagagaggaacagtacaacagcacctaccgggtggtgtccgtgctgacagtgctgcaccaggactggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcctgcccccatcgagaaaaccatcagcaaggccaagggccagccccgcgaaccccaggtgtacacactgcccccaagccgggaagagatgaccaagaaccaggtgtccctgacctgtctcgtgaaaggcttctacccctccgatatcgccgtggaatgggagagcaacggccagcccgagaacaactacaagaccaccccccctgtgctggacagcgacggctcattcttcctgtacagcaagctgaccgtggacaagagccggtggcagcagggcaacgtgttcagctgcagcgtgatgcacgaggccctgcacaaccactacacccagaagtccctgagcctgagccccggcaaatgagtttaaacgggggaggctaact 349 AA PAT REGION 1..349 note Synthetic Construct source 1..349 mol_type protein organism synthetic construct MKHLWFFLLLVAAPRWVLSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 425 DNA PAT misc_feature 1..425 note Nucleotide sequence encoding the light chain of CLCH-A source 1..425 mol_type other DNA organism synthetic construct CDS 26..400 note Encoding polypeptides including a signal sequence (20 aa)followed by CL-A (21-125: 105 aa) ccagcctccggactctagagccaccatggtgctgcagacccaggtgttcatcagcctgctgctgtggatcagcggcgcctatggcgtggcagcccctagcgtgttcatcttcccacccagcgacgagcagctgaagtctggcacagccagcgtcgtgtgcctgctgaacaacttctacccccgcgaggccaaggtgcagtggaaggtggacaatgccctgcagagcggcaacagccaggaaagcgtgaccgagcaggacagcaaggactccacctacagcctgagcagcaccctgaccctgagcaaggccgactacgagaagcacaaggtgtacgcctgcgaagtgacccaccagggcctgtctagccccgtgaccaagagcttcaaccggggcgagtgttgagtttaaacgggggaggctaact 125 AA PAT REGION 1..125 note Synthetic Construct source 1..125 mol_type protein organism synthetic construct MVLQTQVFISLLLWISGAYGVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 1047 DNA PAT misc_feature 1..1047 note Nucleotide sequence encoding the heavy chain of CLCH-B (LALAform) source 1..1047 mol_type other DNA organism synthetic construct CDS 1..1047 note Encoding polypeptides including a signal sequence (19 aa)followed by CH-B (20-349: 330 aa) atgaagcacctgtggttctttctgctgctggtggccgctcccagatgggtgctgagcgcctctacaaagggccccagcgtgttccctctggcccctagcagcaagagcacatctggcggaacagccgccctgggctgcctcgtgaaggactactttcccgagcccgtgaccgtgtcctggaactctggcgctctgacaagcggcgtgcacacctttccagccgtgctgcagagcagcggcctgtactctctgagcagcgtcgtgacagtgcccagcagctctctgggcacccagacctacatctgcaacgtgaaccacaagcccagcaacaccaaggtggacaagcgggtggaacccaagagctgcgacaagacccacacctgtcccccttgtcctgcccccgaagccgcgggaggcccttccgtgttcctgttccccccaaagcccaaggacaccctgatgatcagccggacccccgaagtgacctgcgtggtggtggatgtgtcccacgaggaccctgaagtgaagttcaattggtacgtggacggcgtggaagtgcacaacgccaagaccaagcctagagaggaacagtacaacagcacctaccgggtggtgtccgtgctgacagtgctgcaccaggactggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcctgcccccatcgagaaaaccatcagcaaggccaagggccagccccgcgaaccccaggtgtacacactgcccccaagccgggaagagatgaccaagaaccaggtgtccctgacctgtctcgtgaaaggcttctacccctccgatatcgccgtggaatgggagagcaacggccagcccgagaacaactacaagaccaccccccctgtgctggacagcgacggctcattcttcctgtacagcaagctgaccgtggacaagagccggtggcagcagggcaacgtgttcagctgcagcgtgatgcacgaggccctgcacaaccactacacccagaagtccctgagcctgagccccggcaaa 349 AA PAT REGION 1..349 note Synthetic Construct source 1..349 mol_type protein organism synthetic construct MKHLWFFLLLVAAPRWVLSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 779 DNA PAT misc_feature 1..779 note Nucleotide sequence encoding Fc fragment (wild type) source 1..779 mol_type other DNA organism synthetic construct CDS 26..754 note Encoding polypeptide containing a signal sequence (20 aa)followed by Fc-B (223 aa) ccagcctccggactctagagccaccatggtgctgcagacccaggtgttcatcagcctgctgctgtggatcagcggcgcctacggcacctgtcctccatgtcctgctccagagctgctgggcggacctagcgtgttcctgttccccccaaagcccaaggacaccctgatgatcagccggacccccgaagtgacctgcgtggtggtggatgtgtcccacgaggaccctgaagtgaagttcaattggtacgtggacggcgtggaagtgcacaacgccaagaccaagcccagagaggaacagtacaacagcacctaccgggtggtgtccgtgctgaccgtgctgcaccaggactggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcctgcccccatcgagaaaaccatcagcaaggccaagggccagccccgcgaaccccaggtgtacacactgccccctagcagggacgagctgaccaagaaccaggtgtccctgacctgtctcgtgaagggcttctacccctccgatatcgccgtggaatgggagagcaacggccagcccgagaacaactacaagaccaccccccctgtgctggacagcgacggctcattcttcctgtacagcaagctgacagtggacaagagccggtggcagcagggcaacgtgttcagctgcagcgtgatgcacgaggccctgcacaaccactacacccagaagtccctgagcctgagccccggcaaatgagtttaaacgggggaggctaact 243 AA PAT REGION 1..243 note Synthetic Construct source 1..243 mol_type protein organism synthetic construct MVLQTQVFISLLLWISGAYGTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 741 DNA PAT misc_feature 1..741 note Nucleotide sequence encoding Fc-A (LALA form) source 1..741 mol_type other DNA organism synthetic construct CDS 1..741 note Encoding a signal peptide (20 aa) and Fc-A (227 aa) atggtgctgcagacccaggtgttcatcagcctgctgctgtggatcagcggcgcctacggcgacaaaactcacacctgtcctccatgtcctgctccagaggccgcgggcggacctagcgtgttcctgttccccccaaagcccaaggacaccctgatgatcagccggacccccgaagtgacctgcgtggtggtggatgtgtcccacgaggaccctgaagtgaagttcaattggtacgtggacggcgtggaagtgcacaacgccaagaccaagcccagagaggaacagtacaacagcacctaccgggtggtgtccgtgctgaccgtgctgcaccaggactggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctgcctgcccccatcgagaaaaccatcagcaaggccaagggccagccccgcgaaccccaggtgtacacactgccccctagcagggacgagctgaccaagaaccaggtgtccctgacctgtctcgtgaagggcttctacccctccgatatcgccgtggaatgggagagcaacggccagcccgagaacaactacaagaccaccccccctgtgctggacagcgacggctcattcttcctgtacagcaagctgacagtggacaagagccggtggcagcagggcaacgtgttcagctgcagcgtgatgcacgaggccctgcacaaccactacacccagaagtccctgagcctgagccccggcaaa 247 AA PAT REGION 1..247 note Synthetic Construct source 1..247 mol_type protein organism synthetic construct MVLQTQVFISLLLWISGAYGDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 791 DNA PAT misc_feature 1..791 note DNA fragment containing nucleotide sequence encoding Fc-C (LALA-PA form) source 1..791 mol_type other DNA organism synthetic construct CDS 26..766 note Encoding a signal peptide (20 aa) and Fc-C (227 aa) ccagcctccggactctagagccaccatggtgctgcagacccaggtgttcatcagcctgctgctgtggatctctggcgcctacggcgataagacccacacctgtcctccatgtcctgctccagaagctgctggcggcccttccgtgtttctgttccctccaaagcctaaggacaccctgatgatcagcagaacccctgaagtgacctgcgtggtggtggatgtgtcccacgaggatcccgaagtgaagttcaattggtacgtggacggcgtggaagtgcacaacgccaagaccaagcctagagaggaacagtacaacagcacctacagagtggtgtccgtgctgaccgtgctgcaccaggattggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctggccgctcctatcgagaaaaccatcagcaaggccaagggccagcctagggaaccccaggtttacacactgcctccaagccgggaagagatgaccaagaaccaggtgtccctgacctgcctggtcaagggcttctacccttccgatatcgccgtggaatgggagagcaatggccagcctgagaacaactacaagaccacacctcctgtgctggacagcgacggctcattcttcctgtacagcaagctgacagtggacaagagcagatggcagcagggcaacgtgttcagctgcagcgtgatgcacgaggccctgcacaaccactacacccagaagtccctgagcctgtctcctggcaaatgagtttaaacgggggaggctaact 247 AA PAT REGION 1..247 note Synthetic Construct source 1..247 mol_type protein organism synthetic construct MVLQTQVFISLLLWISGAYGDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALAAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 4 AA PAT REGION 1..4 note Linker L1 source 1..4 mol_type protein organism synthetic construct GGGG 4 AA PAT REGION 1..4 note Linker L1 source 1..4 mol_type protein organism synthetic construct GSGS 000 000 5 AA PAT REGION 1..5 note Linker L1 source 1..5 mol_type protein organism synthetic construct GGEGG 000 000 000 232 AA PAT REGION 1..232 note Polypeptide consisting of hinge, CH2 domain, and CH3 domain ofhuman IgG heavy chain source 1..232 mol_type protein organism synthetic construct EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 12 AA PAT REGION 1..12 note Peptide-124 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine source 1..12 mol_type protein organism synthetic construct SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 12 note C-terminal carboxyl group is linked to N-terminal amino group of linker via amide bond XRSGRDWVRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-125 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as -S-CH2-CO-CH2-S- XRXGRDWXRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-126 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRCGRDWXRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-127 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as -S-CH2-S- XRXGRDWXRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-128 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRCGRDWCRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-129 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide XRXGRDWCRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-130 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as -S-CH2-S- XRCGRDWCRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-131 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as -S-CH2-S- XRCGRDWXRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-132 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as -S-CH2-S- XRXGRDWCRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-133 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3 note L-Penicillamine SITE 3..8 note Thiol groups are linked as -S-CH2-S- XRXGRDWXRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-134 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 8 note L-Penicillamine XRXGRDWXRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-135 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 8 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 3 note L-Penicillamine XRXGRDWXRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-136 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 3 note L-Homocysteine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 8 note L-Penicillamine SITE 3..8 note Thiol groups are linked as -S-CH2-S- XRXGRDWXRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REPEAT 1..12 note Peptide-137 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3 note L-Penicillamine SITE 3..8 note Thiol groups are linked as -S-CH2-S- XRXGRDWCRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-138 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 3..8 note Thiol groups are linked as a disulfide SITE 8 note L-Penicillamine XRCGRDWXRWXC 12 AA PAT source 1..12 mol_type protein organism synthetic construct REGION 1..12 note Peptide-139 SITE 1 note 3-(2-Naphthyl)-L-alanine SITE 11 note L-Cyclopentylglycine SITE 12 note Amidation of C-terminal carboxyl group SITE 1..12 note Thiol group of cysteine is linked to N-terminal end of 3-(2-Naphthyl)-L-alanine via -CH2-CO- SITE 8 note L-Penicillamine SITE 3..8 note Thiol groups are linked as -S-CH2-S- XRCGRDWXRWXC 741 DNA PAT source 1..741 mol_type other DNA organism synthetic construct misc_feature 1..741 note Nucleotide sequence encoding Fc-C (LALA-PA form) CDS 1..741 note Nucleotide sequence encoding Fc-C (LALA-PA form) protein_id 166 translation MVLQTQVFISLLLWISGAYGDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALAAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK atggtgctgcagacccaggtgttcatcagcctgctgctgtggatctctggcgcctacggcgataagacccacacctgtcctccatgtcctgctccagaagctgctggcggcccttccgtgtttctgttccctccaaagcctaaggacaccctgatgatcagcagaacccctgaagtgacctgcgtggtggtggatgtgtcccacgaggatcccgaagtgaagttcaattggtacgtggacggcgtggaagtgcacaacgccaagaccaagcctagagaggaacagtacaacagcacctacagagtggtgtccgtgctgaccgtgctgcaccaggattggctgaacggcaaagagtacaagtgcaaggtgtccaacaaggccctggccgctcctatcgagaaaaccatcagcaaggccaagggccagcctagggaaccccaggtttacacactgcctccaagccgggaagagatgaccaagaaccaggtgtccctgacctgcctggtcaagggcttctacccttccgatatcgccgtggaatgggagagcaatggccagcctgagaacaactacaagaccacacctcctgtgctggacagcgacggctcattcttcctgtacagcaagctgacagtggacaagagcagatggcagcagggcaacgtgttcagctgcagcgtgatgcacgaggccctgcacaaccactacacccagaagtccctgagcctgtctcctggcaaa 247 AA PAT source 1..247 mol_type protein organism synthetic construct MVLQTQVFISLLLWISGAYGDKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALAAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK