PL19-9004WO JP 2022-061625 2022-04-01 Logomix, Inc. Cell suitable for genetic engineering, cell engineering, and cell therapy and method of producing the same 73 20 RNA PAT source 1..20 mol_type other RNA organism Synthetic construct cttcatctccgtcggctacg 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct atgatggaaaactcgatggg 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct tggaatccggtataggcgcc 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct tgagtgacccgataaaactc 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct tcttaaaaacttctatatcg 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct gtgcaactcccgaataggct 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct tgggccttatcatccgtcaa 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct tgggtctgtcgagcacaagg 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct ggtcaaatgccttgtactcg 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct gggagggccggtaccgttga 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct atagctaacgtcactattgc 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct cgttctcagcgcgggcacta 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct gccgctgccgctctacgctt 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct cagaaagggtaagcgcacag 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct ggcgcaacgcgatcgcgtaa 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct gacgccagtgcattcgacga 20 RNA PAT source 1..20 mol_type other RNA organism synthetic construct ggcgcaacgcgatcgcgtaa 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct cctcaccttcccctcttttc 20 DNA PAT source 1..20 mol_type other DNA organism unidentified accttcccctgtgacttgtg 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct ctcaccttcccttcctttcc 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct accttcccctgtgatttgtg 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct ccaccaccctgtctttgact 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tgtcaccccttccttacctg 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct gaggcagaaaggcacacata 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct agcctctccttcccattctt 22 DNA PAT source 1..22 mol_type other DNA organism synthetic construct tccatcaacctctcatagcaaa 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct acttctggaaattccttttgg 18 DNA PAT source 1..18 mol_type other DNA organism synthetic construct gatggcccatgtgtggat 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct ttatcccaggtgcctgtgtc 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct ttcccacttacagccagacc 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tacgggaggtagccagtgtt 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct tgggaagtggtcaggagataa 18 DNA PAT source 1..18 mol_type other DNA organism synthetic construct ggccttccatctgttgct 18 DNA PAT source 1..18 mol_type other DNA organism synthetic construct gacatcggcaaggtgtgg 19 DNA PAT source 1..19 mol_type other DNA organism synthetic construct gtggtggagtgaacggaga 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct tgggaagtggtcaggagataa 24 DNA PAT source 1..24 mol_type other DNA organism synthetic construct tgtaatcttctctgtcgctacttc 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tgcaccagattgttttgtgt 19 DNA PAT source 1..19 mol_type other DNA organism synthetic construct gtggtggagtgaacggaga 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct ccaccttagcctcctcctct 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct aaagcatatttgggcactctg 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct agacaagttcaccccaccag 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tcacctccatgtgccttaca 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct acagagagaagggcacagga 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct catcagcagaagggaggaag 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct aacatgcaaaggggattctg 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tggaagtggcttttggtttc 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tggatttcatgcctcacaaa 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct ttcctcttgtctccccagaa 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct caccatcacccttcttccac 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tgcttcctcttcccagctaa 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct caccatcacccttcttccac 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tgcttcctcttcccagctaa 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct gcagagagtgggaccaagag 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tgctaattctggggagatgg 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tccatcagggtcttctggtc 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct tttttaaccggctctggatg 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct gagagcccttagctggtgtg 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct gtgcagtttgtccacccttt 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct tgggaagtggtcaggagataa 40 DNA PAT source 1..40 mol_type other DNA organism synthetic construct gtctgggtaagggccagggcccccgagagtagcaggagga 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct acgtagggtccttcatcctg 19 DNA PAT source 1..19 mol_type other DNA organism synthetic construct gtggtggagtgaacggaga 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct tgggaagtggtcaggagataa 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct agacaactgccaaggacacc 19 DNA PAT source 1..19 mol_type other DNA organism synthetic construct gtggtggagtgaacggaga 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct ccctgtgtgagtccagaaca 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct tgggaagtggtcaggagataa 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct ccctgtgtgagtccagaaca 19 DNA PAT source 1..19 mol_type other DNA organism synthetic construct gtggtggagtgaacggaga 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct ccctgtgtgagtccagaaca 361 AA PAT source 1..361 mol_type protein organism synthetic construct MAVMAPRTLLLLLSGALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQGSESHSL 14 AA PAT source 1..14 mol_type protein organism synthetic construct AVMAPRTLLLLLSG