WO 23F00022W1 JP 2023-043078 2023-03-17 FUJIFILM Corporation Cyclic peptide or salt thereof and use thereof 346 196 DNA PAT misc_feature 1..196 note Description of Artificial Sequence: Artificial DNA source 1..196 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatatacatatggttaagaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnntagnnnggtggctctggcggtagcaggacggggggcggcggggggtaaataaataagcttgagtat 105 DNA PAT misc_feature 1..105 note Description of Artificial Sequence: Artificial DNA source 1..105 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatatacatatggttaaaaaaacaaaaac 63 DNA PAT misc_feature 1..63 note Description of Artificial Sequence: Artificial DNA source 1..63 mol_type other DNA organism synthetic construct atactcaagcttatttatttattaccccccgccgccccccgtcctgctaccgccagaaccacc 86 DNA PAT misc_feature 1..86 note Description of Artificial Sequence: Artificial DNA source 1..86 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 89 DNA PAT misc_feature 1..89 note Description of Artificial Sequence: Artificial DNA source 1..89 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 92 DNA PAT misc_feature 1..92 note Description of Artificial Sequence: Artificial DNA source 1..92 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 95 DNA PAT misc_feature 1..95 note Description of Artificial Sequence: Artificial DNA source 1..95 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 98 DNA PAT misc_feature 1..98 note Description of Artificial Sequence: Artificial DNA source 1..98 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 101 DNA PAT misc_feature 1..101 note Description of Artificial Sequence: Artificial DNA source 1..101 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 104 DNA PAT misc_feature 1..104 note Description of Artificial Sequence: Artificial DNA source 1..104 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 107 DNA PAT misc_feature 1..107 note Description of Artificial Sequence: Artificial DNA source 1..107 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 110 DNA PAT misc_feature 1..110 note Description of Artificial Sequence: Artificial DNA source 1..110 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 113 DNA PAT misc_feature 1..113 note Description of Artificial Sequence: Artificial DNA source 1..113 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 116 DNA PAT misc_feature 1..116 note Description of Artificial Sequence: Artificial DNA source 1..116 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 119 DNA PAT misc_feature 1..119 note Description of Artificial Sequence: Artificial DNA source 1..119 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 122 DNA PAT misc_feature 1..122 note Description of Artificial Sequence: Artificial DNA source 1..122 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 23 RNA PAT misc_feature 1..23 note Description of Artificial Sequence: Artificial RNA source 1..23 mol_type other RNA organism synthetic construct taccccccgccgccccccgtcct 123 DNA PAT misc_feature 1..123 note Description of Artificial Sequence: Artificial DNA source 1..123 mol_type other DNA organism synthetic construct gttgtaaaacgacggccagtgccaagcttgggctaatacgactcactatagggagagtagttcaatggtagaacgtcggtctctaaaaccgagcgttgagggttcgattcctttctctcccac 18 DNA PAT misc_feature 1..18 note Description of Artificial Sequence: Artificial DNA source 1..18 mol_type other DNA organism synthetic construct gctaccgccagaaccacc 32 DNA PAT misc_feature 1..32 note Description of Artificial Sequence: Artificial DNA source 1..32 mol_type other DNA organism synthetic construct ggagatatacatatggttaagaaaacaaaaac 20 DNA PAT misc_feature 1..20 note Description of Artificial Sequence: Artificial DNA source 1..20 mol_type other DNA organism synthetic construct ctgctaccgccagaaccacc 6 AA PAT REGION 1..6 note Description of Artificial Sequence: Artificial peptide source 1..6 mol_type protein organism synthetic construct VKKTKT 10 AA PAT REGION 1..10 note Description of Artificial Sequence: Artificial peptide source 1..10 mol_type protein organism synthetic construct EQKLISEEDL 11 AA PAT REGION 1..11 note Description of Artificial Sequence: Artificial peptide source 1..11 mol_type protein organism synthetic construct VSGWRLFKKIS 57 AA PAT REGION 1..57 note Description of Artificial Sequence: Artificial peptide source 1..57 mol_type protein organism synthetic construct MVKKTKTHCSYERLQFHGHEAPFRVXVGSGSGSEQKLISEEDLGGSVSGWRLFKKIS 273 DNA PAT misc_feature 1..273 note Description of Artificial Sequence: Artificial DNA source 1..273 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatataccaatggttaaaaaaacaaaaacacattgctcttacgaacgtctgcagttccatggtcatgaagctccgttccgtgtttaggttggttctggcagtggttccgaacagaaactgatcagcgaagaagatctgggtggctctgtaagtggatggcgattattcaagaagattagctaatgaataactaatcc 24 DNA PAT misc_feature 1..24 note Description of Artificial Sequence: Artificial DNA source 1..24 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagg 17 DNA PAT misc_feature 1..17 note Description of Artificial Sequence: Artificial DNA source 1..17 mol_type other DNA organism synthetic construct gaaccactgccagaacc 105 DNA PAT misc_feature 1..105 note Description of Artificial Sequence: Artificial DNA source 1..105 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatataccaatggttaaaaaaacaaaaac 95 DNA PAT misc_feature 1..95 note Description of Artificial Sequence: Artificial DNA source 1..95 mol_type other DNA organism synthetic construct gaaccactgccagaaccaacctaaacacggaacggagcttcatgaccatggaactgcagacgttcgtaagagcaatgtgtttttgtttttttaac 24 DNA PAT misc_feature 1..24 note Description of Artificial Sequence: Artificial DNA source 1..24 mol_type other DNA organism synthetic construct ggattagttattcattagctaatc 107 DNA PAT misc_feature 1..107 note Description of Artificial Sequence: Artificial DNA source 1..107 mol_type other DNA organism synthetic construct ggttctggcagtggttccgaacagaaactgatcagcgaagaagatctgggtggctctgtaagtggatggcgattattcaagaagattagctaatgaataactaatcc 24 AA PAT REGION 1..24 note Description of Artificial Sequence: Artificial peptide source 1..24 mol_type protein organism synthetic construct EQKLISEEDLGGSVSGWRLFKKIS 15 AA PAT REGION 1..15 note Description of Artificial Sequence: Cyclic peptide source 1..15 mol_type protein organism synthetic construct CRALLRGAPFHLAEC 12 AA PAT REGION 1..12 note Description of Artificial Sequence: Cyclic peptide source 1..12 mol_type protein organism synthetic construct CDRTLLYYRLSC 15 AA PAT REGION 1..15 note Description of Artificial Sequence: Cyclic peptide source 1..15 mol_type protein organism synthetic construct CRALLRGAPFHLAEK 12 AA PAT REGION 1..12 note Description of Artificial Sequence: Cyclic peptide source 1..12 mol_type protein organism synthetic construct CDRTLLYYRLSK 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ACVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct GCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct PCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct LCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct VCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct YCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct WCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct NCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct QCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct SCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct TCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct DCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ECVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct RCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct HCVYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICAYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICLYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICIYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICFYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICYYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICTYTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVFTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVWTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVHTFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYAFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYGFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYLFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYIFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYVFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYQFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYSFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYEFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYRFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYHFDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTADAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTGDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTYDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTWDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTSDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTHDAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFAAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFGAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFPAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFVAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFFAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFYAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFWAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFNAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFSAHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDGHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDPHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDLHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDIHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDVHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDYHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDWHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDNHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDQHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDSHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDTHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDEHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDRHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDHHAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAAAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAGAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDALAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAIAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAVAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAFAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAYAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAWAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDANAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAQAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDASAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDATAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDADAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAEAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDARAHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHGHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHIHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHVHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHFHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHYHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHWHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHQHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHSHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHTHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHDHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHEHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHRHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHHHSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAASLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAGSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAPSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHALSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAISLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAVSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAFSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAYSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAWSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHANSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAQSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHASSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHATSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHADSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAESLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHARSLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHALHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHGLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHLLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHILHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHVLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHFLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHYLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHWLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHNLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHQLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHTLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHDLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHELHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHRLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHHLHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSAHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSGHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSPHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSIHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSVHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSFHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSYHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSWHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSQHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSSHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSTHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSEHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSRHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSHHAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLAAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLGAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLPAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLLAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLIAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLVAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLFAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLYAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLWAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLNAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLQAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLSAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLTAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLEAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLRAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHGALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHLALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHIALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHVALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHFALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHYALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHWALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHNALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHQALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHSALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHTALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHDALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHEALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHRALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHHALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAILTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAVLTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHASLTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAAITKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAAVTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAAFTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAATTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALAKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALGKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALPKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALVKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALFKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALNKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALQKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALSKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALEKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALRKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALHKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKA 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKL 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKV 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKF 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKY 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKW 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKN 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKS 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKT 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKR 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHAALTKH 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct VCIYTFNHLAQTYWQSLNKV 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct VCIWVFNRFAHTLKESLTKV 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ACVWTFDRHAQEISQALHKV 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ACVYLFNWRATSYGKSLIKW 21 AA PAT REGION 1..21 note Description of Artificial Sequence: Cyclic peptide source 1..21 mol_type protein organism synthetic construct HCKLYSYPLWYWPKWVFQTKE 21 AA PAT REGION 1..21 note Description of Artificial Sequence: Cyclic peptide source 1..21 mol_type protein organism synthetic construct ACGVHQWEIGEWFGYRYYYKP 21 AA PAT REGION 1..21 note Description of Artificial Sequence: Cyclic peptide source 1..21 mol_type protein organism synthetic construct QCYLPSWFYQKARLLFQYIKS 21 AA PAT REGION 1..21 note Description of Artificial Sequence: Cyclic peptide source 1..21 mol_type protein organism synthetic construct DCTQGKILTYSQALFSFGVKI 22 AA PAT REGION 1..22 note Description of Artificial Sequence: Cyclic peptide source 1..22 mol_type protein organism synthetic construct NCVYYAKPVFAHANRVWTYIKI 22 AA PAT REGION 1..22 note Description of Artificial Sequence: Cyclic peptide source 1..22 mol_type protein organism synthetic construct PCIYTFDQSAIKYKIGFVLRKV 22 AA PAT REGION 1..22 note Description of Artificial Sequence: Cyclic peptide source 1..22 mol_type protein organism synthetic construct PCQSYIWSHFIVVNRQWLHPKW 22 AA PAT REGION 1..22 note Description of Artificial Sequence: Cyclic peptide source 1..22 mol_type protein organism synthetic construct QCWLQGPYWSDIKIYIYQHDKY 22 AA PAT REGION 1..22 note Description of Artificial Sequence: Cyclic peptide source 1..22 mol_type protein organism synthetic construct VCVRPIFIFSFRAPFNAVDWKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct QCIWQYLYQIASLFHVVGKA 19 AA PAT REGION 1..19 note Description of Artificial Sequence: Cyclic peptide source 1..19 mol_type protein organism synthetic construct TCWTAWQWFGHWVPFVAKT 18 AA PAT REGION 1..18 note Description of Artificial Sequence: Cyclic peptide source 1..18 mol_type protein organism synthetic construct RCVYSFDPARYPYHLKKV 22 AA PAT REGION 1..22 note Description of Artificial Sequence: Cyclic peptide source 1..22 mol_type protein organism synthetic construct TCFSPGQIWIWTHLVTAIRNKT 19 AA PAT REGION 1..19 note Description of Artificial Sequence: Cyclic peptide source 1..19 mol_type protein organism synthetic construct LCVYTFNWQQKFGHHLTKI 21 AA PAT REGION 1..21 note Description of Artificial Sequence: Cyclic peptide source 1..21 mol_type protein organism synthetic construct FCTLWQFGNLVWTHESPFIKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct DCVYQYDRNAHYWDTALVKV 21 AA PAT REGION 1..21 note Description of Artificial Sequence: Cyclic peptide source 1..21 mol_type protein organism synthetic construct FCAWVVDYQELHQFWSIVQKI 22 AA PAT REGION 1..22 note Description of Artificial Sequence: Cyclic peptide source 1..22 mol_type protein organism synthetic construct VCVRPIFIFSFRAPFNAVDWKN 21 AA PAT REGION 1..21 note Description of Artificial Sequence: Cyclic peptide source 1..21 mol_type protein organism synthetic construct TCNIWQFNPAARWGFHLVYKY 22 AA PAT REGION 1..22 note Description of Artificial Sequence: Cyclic peptide source 1..22 mol_type protein organism synthetic construct ICREVIVGSLYTWDGNRGFFKV 12 AA PAT REGION 1..12 note Description of Artificial Sequence: Cyclic peptide source 1..12 mol_type protein organism synthetic construct LCYINLFTHTKV 13 AA PAT REGION 1..13 note Description of Artificial Sequence: Cyclic peptide source 1..13 mol_type protein organism synthetic construct WCNFANVWTFNKS 13 AA PAT REGION 1..13 note Description of Artificial Sequence: Cyclic peptide source 1..13 mol_type protein organism synthetic construct QCYHIIVYTFVKP 15 AA PAT REGION 1..15 note Description of Artificial Sequence: Cyclic peptide source 1..15 mol_type protein organism synthetic construct VCIFTWDRVHWPVKV 15 AA PAT REGION 1..15 note Description of Artificial Sequence: Cyclic peptide source 1..15 mol_type protein organism synthetic construct VCIYTWDRQSWPVKL 15 AA PAT REGION 1..15 note Description of Artificial Sequence: Cyclic peptide source 1..15 mol_type protein organism synthetic construct DCIWQWHPWSGYTKL 15 AA PAT REGION 1..15 note Description of Artificial Sequence: Cyclic peptide source 1..15 mol_type protein organism synthetic construct DCIWQWTPTKSFQKL 15 AA PAT REGION 1..15 note Description of Artificial Sequence: Cyclic peptide source 1..15 mol_type protein organism synthetic construct SCIYQWDYVHWPIKL 15 AA PAT REGION 1..15 note Description of Artificial Sequence: Cyclic peptide source 1..15 mol_type protein organism synthetic construct HCLWQWTPQTHFVKL 16 AA PAT REGION 1..16 note Description of Artificial Sequence: Cyclic peptide source 1..16 mol_type protein organism synthetic construct QCWWTLQVWSYPFHKH 16 AA PAT REGION 1..16 note Description of Artificial Sequence: Cyclic peptide source 1..16 mol_type protein organism synthetic construct LCQLGVYTYVALFYKF 16 AA PAT REGION 1..16 note Description of Artificial Sequence: Cyclic peptide source 1..16 mol_type protein organism synthetic construct QCDWVIWQWDPPYIKV 16 AA PAT REGION 1..16 note Description of Artificial Sequence: Cyclic peptide source 1..16 mol_type protein organism synthetic construct PCWWATQIWTYPFYKV 16 AA PAT REGION 1..16 note Description of Artificial Sequence: Cyclic peptide source 1..16 mol_type protein organism synthetic construct FCIYTFSRESGLLWKQ 17 AA PAT REGION 1..17 note Description of Artificial Sequence: Cyclic peptide source 1..17 mol_type protein organism synthetic construct LCPLYAWQTLYQYGWKV 17 AA PAT REGION 1..17 note Description of Artificial Sequence: Cyclic peptide source 1..17 mol_type protein organism synthetic construct ECIYTFDPQRHPVLVKV 17 AA PAT REGION 1..17 note Description of Artificial Sequence: Cyclic peptide source 1..17 mol_type protein organism synthetic construct TCPVWAWHQAFQFGWKI 18 AA PAT REGION 1..18 note Description of Artificial Sequence: Cyclic peptide source 1..18 mol_type protein organism synthetic construct ICPLYGDQGQAWQYGWKL 18 AA PAT REGION 1..18 note Description of Artificial Sequence: Cyclic peptide source 1..18 mol_type protein organism synthetic construct QCLQKVGYLLWQFGWSKI 18 AA PAT REGION 1..18 note Description of Artificial Sequence: Cyclic peptide source 1..18 mol_type protein organism synthetic construct PCPVWGDYGAVHQYGWKV 18 AA PAT REGION 1..18 note Description of Artificial Sequence: Cyclic peptide source 1..18 mol_type protein organism synthetic construct YCVYTFDAQDVWRPLRKV 19 AA PAT REGION 1..19 note Description of Artificial Sequence: Cyclic peptide source 1..19 mol_type protein organism synthetic construct FCIYSWNWNNLVRPEFRKV 19 AA PAT REGION 1..19 note Description of Artificial Sequence: Cyclic peptide source 1..19 mol_type protein organism synthetic construct WCWLIPTPWPGVYQFSPKA 19 AA PAT REGION 1..19 note Description of Artificial Sequence: Cyclic peptide source 1..19 mol_type protein organism synthetic construct QCRITLLTIYQWKYAWHKE 19 AA PAT REGION 1..19 note Description of Artificial Sequence: Cyclic peptide source 1..19 mol_type protein organism synthetic construct QCSWWYVQVWTYPFHVLKG 18 AA PAT REGION 1..18 note Description of Artificial Sequence: Cyclic peptide source 1..18 mol_type protein organism synthetic construct HCLWSLHSFYTFKAWAKI 17 AA PAT REGION 1..17 note Description of Artificial Sequence: Cyclic peptide source 1..17 mol_type protein organism synthetic construct YCPFEVYSWWVPKWHKI 19 AA PAT REGION 1..19 note Description of Artificial Sequence: Cyclic peptide source 1..19 mol_type protein organism synthetic construct LCHLVFQFNPDTGKLWPKY 17 AA PAT REGION 1..17 note Description of Artificial Sequence: Cyclic peptide source 1..17 mol_type protein organism synthetic construct DCPWSVFSWYIPIYNKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDANAQSLDDALNKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDDALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDAALNKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDAALTKV 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDAALTKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDAALNKV 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDAALNKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHDALNKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHDALTKV 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHDALTKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHDALNKV 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLHDALNKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDDALNKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDDALTKV 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDDALTKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDDALNKV 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAHSLDDALNKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLDAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLHDALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLDDALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAQSLDAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAQSLHDALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDAHAQSLDDALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLDAALNKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLHDALNKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLDDALNKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLDAALTKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLHDALTKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLDDALTKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLDAALNKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLHDALNKQ 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct FCVYTFDAHAHSLDDALNKQ 19 AA PAT REGION 1..19 note Description of Artificial Sequence: Cyclic peptide source 1..19 mol_type protein organism synthetic construct CVYTFDAHAHSLDAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDANAHSLDAALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDANAHSLHDALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct ICVYTFDANAHSLDDALTKI 20 AA PAT REGION 1..20 note Description of Artificial Sequence: Cyclic peptide source 1..20 mol_type protein organism synthetic construct IKVYTFDAHAHSLDAALTCI 23 AA PAT REGION 1..23 note Description of Artificial Sequence: Cyclic peptide source 1..23 mol_type protein organism synthetic construct AXVWTFDRHAQEISQALHKVKKK 23 AA PAT REGION 1..23 note Description of Artificial Sequence: Cyclic peptide source 1..23 mol_type protein organism synthetic construct AXVWTFDRHAQEISQALHXVKKK 23 AA PAT REGION 1..23 note Description of Artificial Sequence: Cyclic peptide source 1..23 mol_type protein organism synthetic construct AXVWTFDRHAQEISQALHXVKKK 23 AA PAT REGION 1..23 note Description of Artificial Sequence: Cyclic peptide source 1..23 mol_type protein organism synthetic construct AXVWTFDRHAQEISQALHXVKKK 23 AA PAT REGION 1..23 note Description of Artificial Sequence: Cyclic peptide source 1..23 mol_type protein organism synthetic construct AKVWTFDRHAQEISQALHXVKKK 23 AA PAT REGION 1..23 note Description of Artificial Sequence: Cyclic peptide source 1..23 mol_type protein organism synthetic construct AXVWTFDRHAQEISQALHXVKKK 23 AA PAT REGION 1..23 note Description of Artificial Sequence: Cyclic peptide source 1..23 mol_type protein organism synthetic construct AXVWTFDRHAQEISQALHXVKKK 23 AA PAT REGION 1..23 note Description of Artificial Sequence: Cyclic peptide source 1..23 mol_type protein organism synthetic construct AXVWTFDRHAQEISQALHXVKKK 23 AA PAT REGION 1..23 note Description of Artificial Sequence: Cyclic peptide source 1..23 mol_type protein organism synthetic construct ACVWTFDRHAQEISQALHKVKKK 23 AA PAT source 1..23 mol_type protein organism synthetic construct REGION 1..23 note Description of Artificial Sequence: Cyclic peptide ACVWTFDRHAQEISQALHCVKKK 23 AA PAT source 1..23 mol_type protein organism synthetic construct REGION 1..23 note Description of Artificial Sequence: Cyclic peptide FXVYTFDAHAHSLDAALNXIKKK 23 AA PAT source 1..23 mol_type protein organism synthetic construct REGION 1..23 note Description of Artificial Sequence: Cyclic peptide FXVYTFDAHAHSLDAALNXIKKK 23 AA PAT source 1..23 mol_type protein organism synthetic construct REGION 1..23 note Description of Artificial Sequence: Cyclic peptide FXVYTFDAHAHSLDAALNXIKKK 23 AA PAT source 1..23 mol_type protein organism synthetic construct REGION 1..23 note Description of Artificial Sequence: Cyclic peptide FXVYTFDAHAHSXDAALNXIKKK 22 AA PAT source 1..22 mol_type protein organism synthetic construct REGION 1..22 note Description of Artificial Sequence: Cyclic peptide XVYTFDAHAHSLDAALNXIKKK 22 AA PAT source 1..22 mol_type protein organism synthetic construct REGION 1..22 note Description of Artificial Sequence: Cyclic peptide FXVYTFDAHAHSLDAALNXKKK 55 AA PAT REGION 1..55 note Description of Artificial Sequence: Cyclic peptide source 1..55 mol_type protein organism synthetic construct ACVWTFDRHAQEISQALHKVGSGSGSSGSGSSGSSACVWTFDRHAQEISQALHKV 40 AA PAT REGION 1..40 note Description of Artificial Sequence: Cyclic peptide source 1..40 mol_type protein organism synthetic construct ACVWTFDRHAQEISQALHKVACVWTFDRHAQEISQALHKV 40 AA PAT REGION 1..40 note Description of Artificial Sequence: Cyclic peptide source 1..40 mol_type protein organism synthetic construct FXVYTFDAHAHSLDAALNXIFXVYTFDAHAHSLDAALNXI 40 AA PAT REGION 1..40 note Description of Artificial Sequence: Cyclic peptide source 1..40 mol_type protein organism synthetic construct FXVYTFDAHAHSLDAALNXIFXVYTFDAHAHSLDAALNXI