21F00801W1 JP 2021-157186 2021-09-27 富士フイルム株式会社 FUJIFILM Corporation ポリペプチドの作製方法、タグ、発現ベクター、ポリペプチドの評価方法、核酸ディスプレイライブラリの作製方法及びスクリーニング方法 139 000 000 000 10 AA PAT REGION 1..10 note VKKX Tag SITE 7..10 note UNSURE source 1..10 mol_type protein organism synthetic construct VKKTKTXXXX 39 AA PAT REGION 1..39 note Fusion protein SITE 11 note Chloroacetyl lysine source 1..39 mol_type protein organism synthetic construct ACIPRGDSFAXAGGSEQKLISEEDLGGSVSGWRLFKKIS 120 DNA PAT misc_feature 1..120 note Code sequence of fusion protein misc_feature 31..33 note tag is a triplet to be translated source 1..120 mol_type other DNA organism synthetic construct gcgtgcatcccgcgcggcgattcttttgcataggcaggcggttctgaacagaaactgatcagcgaagaagatctgggtggctctgtaagtggatggcgattattcaagaagattagctaa 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKI 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKK 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKT 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKR 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKS 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKH 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKM 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKP 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKG 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKL 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKV 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKE 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKA 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKD 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKC 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKN 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKY 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKQ 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKW 4 AA PAT REGION 1..4 note VKKX Tag source 1..4 mol_type protein organism synthetic construct VKKF 6 AA PAT REGION 1..6 note VKKX Tag source 1..6 mol_type protein organism synthetic construct VKKTKT 7 AA PAT REGION 1..7 note VKKX Tag source 1..7 mol_type protein organism synthetic construct VKKTKTT 7 AA PAT REGION 1..7 note VKKX Tag source 1..7 mol_type protein organism synthetic construct VKKTKTD 8 AA PAT REGION 1..8 note VKKX Tag source 1..8 mol_type protein organism synthetic construct VKKTKTKK 8 AA PAT REGION 1..8 note VKKX Tag source 1..8 mol_type protein organism synthetic construct VKKTKTKT 8 AA PAT REGION 1..8 note VKKX Tag source 1..8 mol_type protein organism synthetic construct VKKTKTKD 8 AA PAT REGION 1..8 note VKKX Tag source 1..8 mol_type protein organism synthetic construct VKKTKTTK 8 AA PAT REGION 1..8 note VKKX Tag source 1..8 mol_type protein organism synthetic construct VKKTKTTT 8 AA PAT REGION 1..8 note VKKX Tag source 1..8 mol_type protein organism synthetic construct VKKTKTDD 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTKKT 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTKKD 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTKTK 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTKTT 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTKDK 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTKDT 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTKDD 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTTKK 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTTKT 9 AA PAT REGION 1..9 note VKKX Tag source 1..9 mol_type protein organism synthetic construct VKKTKTTKD 10 AA PAT REGION 1..10 note VKKX Tag source 1..10 mol_type protein organism synthetic construct VKKTKTKKTK 10 AA PAT REGION 1..10 note VKKX Tag source 1..10 mol_type protein organism synthetic construct VKKTKTKKDK 10 AA PAT REGION 1..10 note VKKX Tag source 1..10 mol_type protein organism synthetic construct VKKTKTKTKK 10 AA PAT REGION 1..10 note VKKX Tag source 1..10 mol_type protein organism synthetic construct VKKTKTKTTK 10 AA PAT REGION 1..10 note VKKX Tag source 1..10 mol_type protein organism synthetic construct VKKTKTKDKK 10 AA PAT REGION 1..10 note VKKX Tag source 1..10 mol_type protein organism synthetic construct VKKTKTTTKK 11 AA PAT REGION 1..11 note VKKX Tag source 1..11 mol_type protein organism synthetic construct VKKTKTKTDTT 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaaata 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaaaaa 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaaaca 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaacgg 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaatca 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaacat 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaaatg 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaacct 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaaggc 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaacta 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaagtt 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaagaa 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaagca 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaagat 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaatgt 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaaaat 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaatat 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaacaa 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaatgg 12 DNA PAT misc_feature 1..12 note Code sequence of VKKX Tag source 1..12 mol_type other DNA organism synthetic construct gttaaaaaattt 18 DNA PAT misc_feature 1..18 note Code sequence of VKKX Tag source 1..18 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaaca 21 DNA PAT misc_feature 1..21 note Code sequence of VKKX Tag source 1..21 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaca 21 DNA PAT misc_feature 1..21 note Code sequence of VKKX Tag source 1..21 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacagat 24 DNA PAT misc_feature 1..24 note Code sequence of VKKX Tag source 1..24 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaaaa 24 DNA PAT misc_feature 1..24 note Code sequence of VKKX Tag source 1..24 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaaca 24 DNA PAT misc_feature 1..24 note Code sequence of VKKX Tag source 1..24 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaagat 24 DNA PAT misc_feature 1..24 note Code sequence of VKKX Tag source 1..24 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaacaaaa 24 DNA PAT misc_feature 1..24 note Code sequence of VKKX Tag source 1..24 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaacaaca 24 DNA PAT misc_feature 1..24 note Code sequence of VKKX Tag source 1..24 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacagatgat 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tage source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaaaaaca 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaaaagat 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaacaaaa 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaacaaca 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaagataaa 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaagataca 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaagatgat 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaacaaaaaaa 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaacaaaaaca 27 DNA PAT misc_feature 1..27 note Code sequence of VKKX Tag source 1..27 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaacaaaagat 30 DNA PAT misc_feature 1..30 note Code sequence of VKKX Tag source 1..30 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaaaaacaaaa 30 DNA PAT misc_feature 1..30 note Code sequence of VKKX Tag source 1..30 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaaaagataaa 30 DNA PAT misc_feature 1..30 note Code sequence of VKKX Tag source 1..30 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaacaaaaaaa 30 DNA PAT misc_feature 1..30 note Code sequence of VKKX Tag source 1..30 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaacaacaaaa 30 DNA PAT misc_feature 1..30 note Code sequence of VKKX Tag source 1..30 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaagataaaaaa 30 DNA PAT misc_feature 1..30 note Code sequence of VKKX Tag source 1..30 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaacaacaaaaaaa 33 DNA PAT misc_feature 1..33 note Code sequence of VKKX Tag source 1..33 mol_type other DNA organism synthetic construct gttaaaaaaacaaaaacaaaaacagatacaaca 85 DNA PAT misc_feature 1..85 note Synthetic oligonucleotide source 1..85 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatatacca 51 DNA PAT misc_feature 1..51 note Synthetic oligonucleotide source 1..51 mol_type other DNA organism synthetic construct cgcgcgggatgcacgctgtttttgtttttttaaccattggtatatctcctt 30 DNA PAT misc_feature 1..30 note 1st forward primer source 1..30 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagacc 36 DNA PAT misc_feature 1..36 note 1st reverse primer source 1..36 mol_type other DNA organism synthetic construct cctgcctatgcaaaagaatcgccgcgcgggatgcac 74 DNA PAT misc_feature 1..74 note Synthetic oligonucleotide source 1..74 mol_type other DNA organism synthetic construct ggattagttattcattacagatcttcttcgctgatcagtttctgttcagaaccgcctgcctatgcaaaagaatc 23 DNA PAT misc_feature 1..23 note 2nd forward primer source 1..23 mol_type other DNA organism synthetic construct gaaattaatacgactcactatag 23 DNA PAT misc_feature 1..23 note 2nd reverse primer source 1..23 mol_type other DNA organism synthetic construct ggattagttattcattacagatc 240 DNA PAT misc_feature 1..240 note PCR product source 1..240 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatataccaatggttaaaaaaacaaaaacagcgtgcatcccgcgcggcgattcttttgcataggcaggcggttctgaacagaaactgatcagcgaagaagatctgggtggctctgtaagtggatggcgattattcaagaagattagctaatgaataactaatcc 4 AA PAT REGION 1..4 note SKIK Tag source 1..4 mol_type protein organism synthetic construct SKIK 12 DNA PAT misc_feature 1..12 note Code sequence of SKIK Tag source 1..12 mol_type other DNA organism synthetic construct agtaaaattaaa 12 DNA PAT misc_feature 1..12 note Code sequence of SKIK Tag source 1..12 mol_type other DNA organism synthetic construct agtaagattaag 12 DNA PAT misc_feature 1..12 note Code sequence of SKIK Tag source 1..12 mol_type other DNA organism synthetic construct tcgaagatcaag 18 DNA PAT misc_feature 1..18 note Code sequence of VKKX Tag source 1..18 mol_type other DNA organism synthetic construct gttaagaaaaccaagaca 18 DNA PAT misc_feature 1..18 note Code sequence of VKKX Tag source 1..18 mol_type other DNA organism synthetic construct gtgaagaagaccaagacc 80 AA PAT source 1..80 mol_type protein organism synthetic construct REGION 1..80 note Fusion protein VGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPGGSVSGWRLFKKIS 100 AA PAT source 1..100 mol_type protein organism synthetic construct REGION 1..100 note Fusion protein VGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAGGSVSGWRLFKKIS 240 DNA PAT source 1..240 mol_type other DNA organism synthetic construct misc_feature 1..240 note Code sequence of fusion protein gttggatccttgaactgcatcgtagctgtgagccaaaacatgggaattgggaagaacggcgatttaccctggccaccgttgcggaatgaattccgctattttcagcgtatgaccaccacaagttcggtggaagggaaacagaatctggtgatcatgggcaagaaaacgtggtttagcattccggagaagaatcgtcctggtggctctgtaagtggatggcgattattcaagaagattagc 297 DNA PAT source 1..297 mol_type other DNA organism synthetic construct misc_feature 1..297 note Code sequence of fusion protein gttggatccttgaactgcatcgtagctgtgagccaaaacatgggaattgggaagaacggcgatttaccctggccaccgttgcggaatgaattccgctattttcagcgtatgaccaccacaagttcggtggaagggaaacagaatctggtgatcggcaagaaaacgtggtttagcattccggagaagaatcgtcctctgaaaggccgtatcaacctcgttctgtcacgcgaactgaaagagcctccacaaggtgcaggtggctctgtaagtggatggcgattattcaagaagattagc 558 DNA PAT source 1..558 mol_type other DNA organism synthetic construct misc_feature 1..558 note Code sequence of DHRF gttggatccttgaactgcatcgtagctgtgagccaaaacatgggaattgggaagaacggcgatttaccctggccaccgttgcggaatgaattccgctattttcagcgtatgaccaccacaagttcggtggaagggaaacagaatctggtgatcatgggcaagaaaacgtggtttagcattccggagaagaatcgtcctctgaaaggccgtatcaacctcgttctgtcacgcgaactgaaagagcctccacaaggtgcacacttccttagccgcagtcttgatgatgccctgaaactgactgaacagcccgaattagcgaacaaagtcgatatggtctggattgtaggtggctcttccgtgtacaaagaagcgatgaatcatccgggtcatctgaaactgtttgttacgcgcattatgcaggactttgaatcggataccttctttccggaaattgacctcgagaaatacaaactgttaccggaatatccgggtgttctgtctgatgtgcaggaagagaaaggcatcaaatacaaattcgaagtctatgagaagaacgac 55 DNA PAT source 1..55 mol_type other DNA organism synthetic construct misc_feature 1..55 note Forward primer for VKKTKT tag aaggagatataccaatggttaaaaaaacaaaaacagttggatccttgaactgcat 49 DNA PAT source 1..49 mol_type other DNA organism synthetic construct misc_feature 1..49 note Forward primer for SKIK tag aaggagatataccaatgtcgaagatcaaggttggatccttgaactgcat 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct misc_feature 1..20 note 1st reverse primer ttagtcgttcttctcataga 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct misc_feature 1..21 note 2nd reverse primer aggacgattcttctccggaat 21 DNA PAT source 1..21 mol_type other DNA organism synthetic construct misc_feature 1..21 note 2nd reverse primer tgcaccttgtggaggctcttt 80 DNA PAT source 1..80 mol_type other DNA organism synthetic construct ggattagttattcattagctaatcttcttgaataatcgccatccacttacagagccaccaggacgattcttctccggaat 80 DNA PAT source 1..80 mol_type other DNA organism synthetic construct ggattagttattcattagctaatcttcttgaataatcgccatccacttacagagccacctgcaccttgtggaggctcttt 24 AA PAT source 1..24 mol_type protein organism synthetic construct EQKLISEEDLGGSVSGWRLFKKIS 16 AA PAT source 1..16 mol_type protein organism synthetic construct SITE 10 note Chloroacetyl lysine CEPRGDNYRXGGSKKK 202 DNA PAT source 1..202 mol_type other DNA organism synthetic construct misc_feature 89..106 note VKKX Tag gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatatacatatggttaagaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnntagnnnggtggctctggcggtagcaggacggggggcggcggggggtaaataaataagcttgagtat 199 DNA PAT source 1..199 mol_type other DNA organism synthetic construct misc_feature 89..106 note VKKX Tag gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatatacatatggttaagaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnntagnnnggtggctctggcggtagcggcggggggcgggaggcgggaataaataagcttgagtat 105 DNA PAT source 1..105 mol_type other DNA organism synthetic construct gaaattaatacgactcactatagggagaccacaacggtttccctctagaaataattttgtttaactttaagaaggagatatacatatggttaaaaaaacaaaaac 92 DNA PAT source 1..92 mol_type other DNA organism synthetic construct aagaaggagatatacatatggttaaaaaaacaaaaacannntgtnnnnnnnnnnnnnnnnnnnnnnnntagnnnggcggttctggcggtagc 63 DNA PAT source 1..63 mol_type other DNA organism synthetic construct atactcaagcttatttatttattaccccccgccgccccccgtcctgctaccgccagaaccacc 61 DNA PAT source 1..61 mol_type other DNA organism synthetic construct atactcaagcttatttatttatcccgcctcccgccccccgtccgctaccgccagaaccacc 23 DNA PAT source 1..23 mol_type other DNA organism synthetic construct taccccccgccgccccccgtcct 23 RNA PAT source 1..23 mol_type other RNA organism synthetic construct modified_base 1 mod_base um modified_base 2 mod_base OTHER note 2'-O-methyladenosine modified_base 3..8 mod_base cm modified_base 9 mod_base gm modified_base 10..11 mod_base cm modified_base 11 mod_base gm modified_base 13..18 mod_base cm modified_base 19 mod_base gm modified_base 20 mod_base um modified_base 21..22 mod_base cm modified_base 23 mod_base um taccccccgccgccccccgtcct 23 RNA PAT source 1..23 mol_type other RNA organism synthetic construct modified_base 1 mod_base um modified_base 2 mod_base OTHER note 2'-O-methyladenosine modified_base 3..8 mod_base cm modified_base 9 mod_base gm modified_base 10..11 mod_base cm modified_base 12 mod_base gm modified_base 13..18 mod_base cm modified_base 19 mod_base gm modified_base 20 mod_base um modified_base 21..22 mod_base cm modified_base 23 mod_base um taccccccgccgccccccgtcct 21 RNA PAT source 1..21 mol_type other RNA organism synthetic construct modified_base 1..3 mod_base cm modified_base 4 mod_base gm modified_base 5..6 mod_base cm modified_base 7 mod_base um modified_base 8..10 mod_base cm modified_base 11 mod_base gm modified_base 12..17 mod_base cm modified_base 18 mod_base gm modified_base 19 mod_base um modified_base 20..21 mod_base cm cccgcctcccgccccccgtcc 18 DNA PAT source 1..18 mol_type other DNA organism synthetic construct gctaccgccagaaccacc 32 DNA PAT source 1..32 mol_type other DNA organism synthetic construct ggagatatacatatggttaagaaaacaaaaac 20 DNA PAT source 1..20 mol_type other DNA organism synthetic construct ctgctaccgccagaaccacc